KEGG   Streptococcus agalactiae ILRI005: MSA_10000Help
Entry
MSA_10000         CDS       T02704                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme,GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sagi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879026..880894
Genome map
AA seq 622 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENGSFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWETNSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYMERRPGTASVIKVLRDKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDYLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGTLNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEGPWEANQFGDNRNLEGYHFLRKLNKVIKERHPNVMMIAEESTASTPIT
KDLESGGLGFDFKWNMGWMNDILRFYEEDPLYRQYDFNLVTFSFMYIFNENFVLAFSHDE
VVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQFLEWKYNDQLEWE
NLNDDMNQKMQRYTKQLNQFYKDHKCLWRIDDSFDGLEIIDADNKSETVLSFIRKDDKGD
LLLCVFNMTPVERPNFTIGVPQAGIYEEVLNTEMEEFGGVWKNHNPVTKTQVATWKDYDH
TLSFTLPALGASVWRIKRRLRK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatggaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgccctctccaaatgaac
aaaaatcaagcaggagtttgggaaactaacagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tatatggaaagacgtcctggaactgcaagtgttattaaagttcttagagataaaaagtgg
gaagatggtctttggatgggaaggcgcaaacgtctggggtttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagactacttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtagaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgat
gatgctttagcctatttcgatggaactgctacttatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggaactctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttattctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaaggaccatgggaagctaaccaattt
ggggataatcgtaatttggaagggtatcactttttaaggaaacttaacaaagtaattaaa
gagcgtcatcctaatgttatgatgattgctgaagagtcaacagcttctaccccaataact
aaagacttagaatctggaggattgggttttgactttaaatggaatatgggctggatgaat
gatatcctgcgtttttatgaagaagatcctctctataggcaatatgattttaatttagtg
acctttagttttatgtatatattcaatgagaactttgtactagctttttcacatgatgaa
gtagtacatggtaaaaagagtatgatgcataaaatgtggggtgaccgttataatcaattt
gctggtttacgtaacttatatgcatatcaaatgtgtcatcctgggaagaaacttctcttt
atgggaagtgagttcggtcaatttttagaatggaaatataatgatcaactagaatgggaa
aacttaaatgatgatatgaaccaaaagatgcaacgctatactaaacaattgaatcaattt
tataaagatcataagtgcctatggcgtattgatgattcctttgacggtctagaaattatt
gatgcggataataaatctgaaactgttttatcttttatacgaaaagatgataaaggggat
ttgttactttgtgtctttaatatgactcctgtagaacgccctaactttactattggtgtt
ccgcaagcgggtatttatgaagaagttttaaatactgaaatggaagagtttggaggtgtt
tggaaaaaccacaatcctgtaacgaaaacacaagtggctacatggaaagattatgatcat
actttaagttttacattaccagcccttggggcaagtgtttggagaataaaacgtcggctt
cgtaaataa

DBGET integrated database retrieval system