KEGG   Streptococcus agalactiae ILRI005: MSA_18010Help
Entry
MSA_18010         CDS       T02704                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00220  Arginine biosynthesis
sagi00250  Alanine, aspartate and glutamate metabolism
sagi00290  Valine, leucine and isoleucine biosynthesis
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01130  Biosynthesis of antibiotics
sagi01210  2-Oxocarboxylic acid metabolism
sagi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MSA_18010
   00290 Valine, leucine and isoleucine biosynthesis
    MSA_18010
   00220 Arginine biosynthesis
    MSA_18010
Enzymes [BR:sagi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MSA_18010
    2.6.1.66  valine---pyruvate transaminase
     MSA_18010
Amino acid related enzymes [BR:sagi01007]
 Aminotransferase (transaminase)
  Class I
   MSA_18010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cor1
Motif
Other DBs
NCBI-ProteinID: CCW40657
Position
complement(1664141..1665352)
Genome map
AA seq 403 aa AA seqDB search
MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAAFGFEAPDEVIRDLIT
NARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVSEGISMSMQALLDNDDE
VLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPT
GAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPIASIAEDIFTVTLSGLSKS
HRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLAQQVIQTSLGGQQSIDSMLL
PGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTDMYRIDNDEEFVLNFLKQEKV
LLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLSQYKR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttgataaatcaatgaagctggaacatgtggcttatgatattagaggccct
gttttagaagaggcggaccgcatgagggcaaatggtgaaaagatattgcggttaaatact
ggaaatccagctgcctttggcttcgaagcgccagatgaagtcattcgtgatttaattacg
aatgcgcgtgaatcagaaggttactctgattcgaaaggtattttttcagctcgtaaggct
gttatgcagtattaccagttacaaaacatccatgttgacatggatgatatatacattgtt
aatggtgttagtgagggaatctctatgtcaatgcaagctttgcttgataatgatgacgag
gttctagttccaatgccagattacccgttatggacagcttgtgttagccttgctggtgga
aatgctgtgcattatatttgtgatgaggaagctaattggtatcctgatattgatgatatc
aaatcaaaaatcacatccaaaacaaaagcaattgtcctcattaatccaaataatccaact
ggagcagtctatccgcgtgaaattctgcaagagattgtggatatcgctagacaaaatgac
ttgattattttttcagacgaggtttatgaccgtttagttatggatggaatggagcatatc
ccaattgcttctattgcagaggatatttttacagttactttatctggcttatctaaatca
catcgcatctgtggtttccgcgttggttggatggtattgtctggtccgcgacaacatgtt
aaaggttatattgaaggtttgaatatgttagctaacatgaggctgtgttcaaatgttctt
gctcaacaggttattcaaacatcgttaggcggacagcaatctattgatagtatgttgttg
ccaggaggtcgtatctacgagcaacgtaattatatccataaagcaattaatgaaataccc
ggtttatctgctgtaaaaccaaatgctggactgtatcttttccctaaaattgatacagat
atgtaccgtattgataatgatgaagagtttgtgcttaatttcttaaaacaagaaaaagta
ttactaacacacggtagaggatttaatatgaataccgctgaccattttagaattgtttac
ttaccacgtgttgatgaattgactgaactacaagaaaaaatggctcgctttttaagccaa
tacaagcgctag

DBGET integrated database retrieval system