KEGG   Streptococcus agalactiae ILRI005: MSA_3490Help
Entry
MSA_3490          CDS       T02704                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00330  Arginine and proline metabolism
sagi00332  Carbapenem biosynthesis
sagi01100  Metabolic pathways
sagi01130  Biosynthesis of antibiotics
sagi01230  Biosynthesis of amino acids
Module
sagi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sagi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MSA_3490
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MSA_3490
Enzymes [BR:sagi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MSA_3490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: CCW39226
Position
284014..284817
Genome map
AA seq 267 aa AA seqDB search
MKRHFETTRRIVIKVGTSSLVQTSGKINLSKIDHLAFVISSLMNRGMEVILVSSGAMGFG
LDILKMDKRPQEISQQQAVSSVGQVAMMSLYSQIFSHYQTHVSQILLTRDVVVFPESLQN
VTNSFESLLSMGILPIVNENDAVSVDEMDHKTKFGDNDRLSAVVAKITKADLLIMLSDID
GLFDKNPNIYDDAVLRSHVSEITDDIIKSAGGAGSKFGTGGMLSKIKSAQMVFDNNGQMI
LMNGANPRDILKVLDGHNIGTYFAQGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacattttgagacaactagaagaattgttattaaagtaggaaccagttccctc
gtacagacaagcgggaaaattaatttaagtaaaatagaccatttagcatttgttatttct
agtcttatgaatagaggcatggaggtgattttagtatcatctggagctatggggtttggt
ttagacattttgaaaatggataagcgtcctcaagaaatatcacaacaacaagcagtttct
agcgtaggacaagtagccatgatgagtctttattctcagatattttcgcactatcaaact
catgtttcccaaattttattaacacgtgacgttgtggtttttccagagagtttgcaaaat
gtaacaaactcttttgagagtctgctctctatgggaattttgccaatcgtcaatgagaat
gatgctgtcagcgtggatgagatggatcataaaacgaagtttggggacaatgaccgtctc
tctgctgtcgttgctaaaattactaaagcagatttattaattatgctgtcagatattgat
ggtctttttgataaaaatcctaatatttatgatgatgctgttttacgtagtcatgtttct
gagatcaccgatgacatcatcaagtcagctggaggagcaggaagtaagtttggtactggt
ggtatgcttagtaaaattaaaagtgcacaaatggtgtttgataacaatggacaaatgata
ttgatgaatggcgccaatcctcgtgatattttaaaggtgttagatgggcataatattgga
acttattttgctcaaggaaagtga

DBGET integrated database retrieval system