KEGG   Streptococcus agalactiae ILRI005: MSA_8500Help
Entry
MSA_8500          CDS       T02704                                 

Definition
Cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sagi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726681..728147
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEDSISDLKKLGVSKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKHPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKTKPDLEVFGEYWKSDQRSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEVIDKMAELRQNYVFGKQVDYFTHSNCIGWTCLGDEEH
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVESASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagaggactctatatcagaccttaaaaaacttggagttagtaaaatctgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtaggaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccgtttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcatcaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgagattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagcatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactaccggtattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaacaaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaagatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgttaccttgcatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgacgatagtctcgttattgataatcct
gagtatgctgttacattcgtagaaaatcatgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaaacctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattactatggcattcaaggagaatttggtcaaccatcc
tttaaagaggttattgataaaatggctgagctacgccaaaactatgtatttggcaaacaa
gtcgattattttacgcattcaaattgtattggttggacttgtcttggggatgaggaacat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacttttgttgattatttaggcaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgaatctgcgtctatctcggcttgg
gtccctaaaatagaggaagctaactga

DBGET integrated database retrieval system