KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0045Help
Entry
GBS222_0045       CDS       T02656                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sagl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GBS222_0045 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GBS222_0045 (proB)
Enzymes [BR:sagl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GBS222_0045 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
51834..52637
Genome map
AA seq 267 aa AA seqDB search
MKRHFETTRRIVIKVGTSSLVQTSGKINLSKIDHLAFVISSLMNKGMEVILVSSGAMGFG
LDILKMDKRPQEISQQQAVSSVGQVAMMSLYSQIFSHYQTHVSQILLTRDVVVFPESLQN
VTNSFESLLSMGILPIVNENDAVSVDEMDHKTKFGDNDRLSAVVAKITKADLLIMLSDID
GLFDKNPNIYDDAVLRSHVSEITDDIIKSAGGAGSKFGTGGMLSKIKSAQMVFDNNGQMI
LMNGANPRDILKVLDGHNIGTYFAQGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacattttgagacaactagaagaattgttattaaagtaggaaccagttccctc
gtacagacaagcgggaaaattaatttaagtaaaatagaccatttagcatttgttatttct
agtcttatgaataaaggtatggaggtgattttagtatcatctggagctatggggtttggt
ttagacattttgaaaatggataagcgtcctcaagaaatatcacaacaacaagcagtttct
agcgtagggcaagtagccatgatgagtctttattctcagatattttcgcactatcaaact
catgtttcccaaattttattaacacgtgacgttgtggtttttccagagagtttgcaaaat
gtaacaaactcttttgagagtctgctctctatgggaattttgccaatcgtcaatgagaat
gatgctgtcagcgtggatgagatggatcataaaacgaagtttggggataatgaccgtctc
tctgctgtcgttgctaaaattactaaagcagatttattaattatgctgtcagatattgat
ggtctttttgataaaaatcctaatatttatgatgatgctgttttacgtagtcatgtttct
gagatcaccgatgacatcatcaagtcagctggaggagcaggaagtaagtttggtactggt
ggtatgcttagtaagattaaaagtgcacaaatggtgtttgataacaatggacaaatgata
ttgatgaatggcgccaatcctcgtgatattttaaaggtgttagatgggcataatattgga
acttattttgctcaaggaaagtga

DBGET integrated database retrieval system