KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0724Help
Entry
GBS222_0724       CDS       T02656                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sagl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762237..764105
Genome map
AA seq 622 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENESFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWEANSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYMERRPGTASVIKVLRNKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDCLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGALNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEGPWEANQFGDNRNLEGYHFLRKLNKVIKERHPNVMMIAEESTASTPIT
KDLESGGLGFDFKWNMGWMNDILRFYEEDPLYRQYDFNLVTFSFMYIFNENFVLAFSHDE
VVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQFLEWKYNDQLEWG
NLNDDMNQKMQRYTKQLNQFYKDYKCLWRIDDSFDGLEIIDADNKSETVLSFIRKDDKGD
LLLCVFNMTPVERPNFTIGVPRAGIYEEVLNTEMEEFGGVWKNHNPVTKTQVATWKDYDH
TLSFTLPALWASVWRIKRRLRK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatgaaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgccctctccaaatgaac
aaaaatcaagcaggagtttgggaagctaacagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tatatggaaagacgtcctggaactgcaagtgttattaaagttcttagaaataaaaagtgg
gaagatggcctttggatgggaaggcgcaaacgtctgggttttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagactgcttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtggaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgat
gatgctttagcctatttcgatggaactgctacttatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggagctctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttattctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaaggaccatgggaagctaaccaattt
ggggataatcgtaatttggaagggtatcactttttaaggaaacttaacaaagtaattaaa
gagcgtcatcctaatgttatgatgattgctgaagagtcaacagcttctaccccaataact
aaagacttagagtctggaggattgggttttgactttaaatggaatatgggctggatgaat
gatatcctgcgtttttatgaagaagatcctctctataggcaatatgattttaatttagtg
acttttagttttatgtatatattcaatgagaactttgtactagctttttcacatgatgaa
gtagtacatggtaaaaagagtatgatgcataaaatgtggggtgaccgttataatcaattt
gctggtttacgtaatttatatgcatatcaaatgtgtcatcctgggaaaaaacttctcttt
atgggaagtgagttcggtcaatttttagaatggaaatataatgatcaactagaatgggga
aacttaaatgatgatatgaaccaaaagatgcaacgctatactaaacaattgaatcaattt
tataaagattataagtgcctatggcgtattgatgattcttttgacgggctagaaattatt
gatgcggataataaatctgaaactgttttatcttttatacgaaaagatgataaaggcgat
ttattactttgtgtctttaatatgactcctgtagaacgccctaactttactattggtgtt
ccgcgagcgggtatttatgaagaagttttaaatactgaaatggaagagtttggaggtgtt
tggaaaaaccacaatcctgtaacgaaaacacaagtggctacatggaaagattatgatcat
actttaagttttacattaccagccctttgggcaagtgtttggagaataaaacgtcggctt
cgtaaataa

DBGET integrated database retrieval system