KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_0902Help
Entry
GBS222_0902       CDS       T02656                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GBS222_0902 (tdk)
Enzymes [BR:sagl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GBS222_0902 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(953843..954412)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAV
PISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggaaaacctgtggttattatgacaagcgccttg
gacactcgagatgaatttggagtcgtttcaagtcgtattggaatgcgtcgtgaagcagtt
ccaatttcagatgatatggacattttctcctatattcagaatttaccacaaaagccttat
tgtgttttaattgatgaatgtcaatttttgagtaagaaaaacgtctacgatttagctaga
gtagtagatgacttagatgtaccagtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system