KEGG   Streptococcus agalactiae 2-22 (serotype Ib): GBS222_1402Help
Entry
GBS222_1402       CDS       T02656                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sagl  Streptococcus agalactiae 2-22 (serotype Ib)
Pathway
sagl00220  Arginine biosynthesis
sagl00250  Alanine, aspartate and glutamate metabolism
sagl00290  Valine, leucine and isoleucine biosynthesis
sagl01100  Metabolic pathways
sagl01110  Biosynthesis of secondary metabolites
sagl01130  Biosynthesis of antibiotics
sagl01210  2-Oxocarboxylic acid metabolism
sagl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GBS222_1402
   00290 Valine, leucine and isoleucine biosynthesis
    GBS222_1402
   00220 Arginine biosynthesis
    GBS222_1402
Enzymes [BR:sagl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     GBS222_1402
    2.6.1.66  valine---pyruvate transaminase
     GBS222_1402
Amino acid related enzymes [BR:sagl01007]
 Aminotransferase (transaminase)
  Class I
   GBS222_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cor1
Motif
Other DBs
NCBI-ProteinID: CCO75077
UniProt: R4ZCL6
Position
complement(1449307..1450518)
Genome map
AA seq 403 aa AA seqDB search
MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAAFGFEAPDEVIRDLIT
NARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVSEGISMSMQALLDNDDE
VLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPT
GAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPIASIAEDIFTVTLSGLSKS
HRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLAQQVIQTSLGGQQSIDSMLL
PGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTDMYRIDNDEEFVLNFLKQEKV
LLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLSQYKR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttgataaatcaatgaagctggaacatgtggcttatgatattagaggccct
gttttagaagaggcggaccgcatgagggcaaatggtgaaaagatattgcggttaaatact
ggaaatccagctgcctttggcttcgaagccccagatgaagtcattcgtgatttaattacg
aatgcgcgtgaatcagaaggttactctgattcgaaaggtattttttcagctcgtaaggct
gttatgcagtattaccagttacaaaacatccatgttgacatggatgatatatacattgtt
aatggtgttagtgagggaatctctatgtcaatgcaagctttgcttgataatgatgacgag
gttctagttccaatgccagattacccgttatggacagcttgtgttagccttgctggtgga
aatgctgtgcattatatttgtgatgaggaagctaattggtatcctgatattgatgatatc
aaatcaaaaatcacatccaaaacaaaagcaatcgtcctcattaatccaaataatccaact
ggagcagtctatccgcgtgaaattctgcaagagattgtggatatcgctagacaaaatgac
ttgattattttttcagacgaggtttatgaccgtttagttatggatggaatggagcatatc
ccaattgcttctattgcagaggatatttttacagttactttatctggcttatctaaatca
catcgcatctgtggtttccgcgttggttggatggtattgtctggtccgcgacaacatgtt
aaaggttatattgaaggtttgaatatgttagctaatatgaggctgtgttcaaatgttctt
gctcaacaggttattcaaacatcgttaggcggacagcaatctattgatagtatgttgttg
ccaggaggtcgtatctacgagcaacgtaattatatccataaagcaattaatgaaatacct
ggtttatctgctgtaaaaccaaatgctggactgtatcttttccctaaaattgatacagat
atgtaccgtattgataatgatgaagagtttgtgcttaatttcttaaaacaagaaaaagta
ttactaacacacggtagaggatttaatatgaataccgctgaccattttagaattgtttac
ttaccacgtgttgatgaattgactgaactacaagaaaaaatggctcgctttttaagccaa
tacaagcgctag

DBGET integrated database retrieval system