KEGG   Streptococcus agalactiae 09mas018883: BSA_14140Help
Entry
BSA_14140         CDS       T02703                                 

Definition
NADP-specific glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sagm00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sagm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sagm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1371047..1372396)
Genome map
AA seq 449 aa AA seqDB search
MTSGKTYVASVLEKVKKQNEHEEEFLQAVEEVFESLVPVFDRYPQYIEENLLERLVEPER
VISFRVPWVDDKGQVQVNRGYRVQFSSAIGPYKGGLRFHPTVTQSIVKFLGFEQIFKNSL
TGLPIGGGKGGSNFDPKGKSDNEVMRFTQSFMTELQKYIGPDLDVPAGDIGVGGREIGYL
YGQYKRLNGYQNGVLTGKGLTYGGSLVRTEATGYGAVYFAKEMLAARGQDLTGKVALVSG
SGNVAIYATEKLQELGATVVAVSDSSGYVYDPDGIDLETLKQIKEVERARIVKYTEKHPK
ANFTPADQGSIWSIKADLAFPCATQNELDEEDAKLLVENGVLAVTEGANMPSTLGAIKVF
QKAGVAFGPAKAANAGGVAVSALEMAQNSSRRAWTFEEVDQELQRIMKTIFVNASEATDE
FGDSGNLVLGANIAGFLKVAQAMSAQGIV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcggaaagacatatgtagcaagtgttttagagaaagtgaagaagcaaaatgag
catgaggaagaatttctacaagcggttgaagaggtttttgagtcactagtaccagttttt
gatagataccctcagtacattgaagaaaatcttttagaacgtttggttgagcctgagcgc
gtgatttcttttagagttccatgggtagatgataaaggtcaggttcaagttaaccgagga
tatcgtgtacaattttcatcagctattggtccttataaaggtggtttacgttttcaccct
acagtaacacaatctattgtcaaatttttaggatttgaacaaatttttaagaattcactg
acaggtctaccaattggtggtggcaaaggagggtcgaactttgatccaaaagggaaatca
gataatgaagtgatgcgtttcacacaaagttttatgaccgaacttcaaaaatacattgga
ccagatttagatgtgccggctggcgatattggagtaggtggacgtgaaattggttacctt
tatggtcaatataagcgtttaaatggttatcaaaatggtgttttaaccggaaaaggtctg
acttatggtggctctttggttcgtacagaagcaactggttatggggcagtctattttgct
aaagaaatgctagcagcgcgtggtcaagatttaactggcaaagttgcactggtttcggga
tctggtaacgtggctatttatgctactgaaaaattacaagagttgggtgcaactgttgta
gctgtgtcagattcttcaggttatgtttatgatccagatggtattgaccttgaaactttg
aaacagataaaagaggttgaaagagcacgtattgtcaaatatacagagaaacatccaaaa
gctaatttcacaccagcagatcaaggtagtatctggtctattaaagcagatttagctttc
ccgtgtgctactcaaaacgaattagacgaagaagacgctaagttattagttgaaaatggt
gtcttggcagtaacagaaggagcaaatatgccatctaccttgggtgctattaaagttttc
caaaaggcaggggttgcttttggtcctgctaaagctgccaatgcaggaggagtagctgtt
tcagcgcttgaaatggcacaaaattctagtcgtagggcatggacttttgaagaagttgat
caagaattgcaacgtattatgaaaactatttttgtgaatgcttccgaagcgactgatgaa
tttggcgatagtggtaacctggttctaggtgctaacattgcaggctttttaaaagttgct
caagctatgtctgcacaaggtattgtttaa

DBGET integrated database retrieval system