KEGG   Streptococcus agalactiae 09mas018883: BSA_14140Help
Entry
BSA_14140         CDS       T02703                                 

Definition
NADP-specific glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BSA_14140
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSA_14140
   00330 Arginine and proline metabolism
    BSA_14140
Enzymes [BR:sagm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     BSA_14140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1371047..1372396)
Genome map
AA seq 449 aa AA seqDB search
MTSGKTYVASVLEKVKKQNEHEEEFLQAVEEVFESLVPVFDRYPQYIEENLLERLVEPER
VISFRVPWVDDKGQVQVNRGYRVQFSSAIGPYKGGLRFHPTVTQSIVKFLGFEQIFKNSL
TGLPIGGGKGGSNFDPKGKSDNEVMRFTQSFMTELQKYIGPDLDVPAGDIGVGGREIGYL
YGQYKRLNGYQNGVLTGKGLTYGGSLVRTEATGYGAVYFAKEMLAARGQDLTGKVALVSG
SGNVAIYATEKLQELGATVVAVSDSSGYVYDPDGIDLETLKQIKEVERARIVKYTEKHPK
ANFTPADQGSIWSIKADLAFPCATQNELDEEDAKLLVENGVLAVTEGANMPSTLGAIKVF
QKAGVAFGPAKAANAGGVAVSALEMAQNSSRRAWTFEEVDQELQRIMKTIFVNASEATDE
FGDSGNLVLGANIAGFLKVAQAMSAQGIV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcggaaagacatatgtagcaagtgttttagagaaagtgaagaagcaaaatgag
catgaggaagaatttctacaagcggttgaagaggtttttgagtcactagtaccagttttt
gatagataccctcagtacattgaagaaaatcttttagaacgtttggttgagcctgagcgc
gtgatttcttttagagttccatgggtagatgataaaggtcaggttcaagttaaccgagga
tatcgtgtacaattttcatcagctattggtccttataaaggtggtttacgttttcaccct
acagtaacacaatctattgtcaaatttttaggatttgaacaaatttttaagaattcactg
acaggtctaccaattggtggtggcaaaggagggtcgaactttgatccaaaagggaaatca
gataatgaagtgatgcgtttcacacaaagttttatgaccgaacttcaaaaatacattgga
ccagatttagatgtgccggctggcgatattggagtaggtggacgtgaaattggttacctt
tatggtcaatataagcgtttaaatggttatcaaaatggtgttttaaccggaaaaggtctg
acttatggtggctctttggttcgtacagaagcaactggttatggggcagtctattttgct
aaagaaatgctagcagcgcgtggtcaagatttaactggcaaagttgcactggtttcggga
tctggtaacgtggctatttatgctactgaaaaattacaagagttgggtgcaactgttgta
gctgtgtcagattcttcaggttatgtttatgatccagatggtattgaccttgaaactttg
aaacagataaaagaggttgaaagagcacgtattgtcaaatatacagagaaacatccaaaa
gctaatttcacaccagcagatcaaggtagtatctggtctattaaagcagatttagctttc
ccgtgtgctactcaaaacgaattagacgaagaagacgctaagttattagttgaaaatggt
gtcttggcagtaacagaaggagcaaatatgccatctaccttgggtgctattaaagttttc
caaaaggcaggggttgcttttggtcctgctaaagctgccaatgcaggaggagtagctgtt
tcagcgcttgaaatggcacaaaattctagtcgtagggcatggacttttgaagaagttgat
caagaattgcaacgtattatgaaaactatttttgtgaatgcttccgaagcgactgatgaa
tttggcgatagtggtaacctggttctaggtgctaacattgcaggctttttaaaagttgct
caagctatgtctgcacaaggtattgtttaa

DBGET integrated database retrieval system