KEGG   Streptococcus agalactiae 09mas018883: BSA_1710Help
Entry
BSA_1710          CDS       T02703                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sagm  Streptococcus agalactiae 09mas018883
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sagm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSA_1710
Enzymes [BR:sagm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSA_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128170..129081)
Genome map
AA seq 303 aa AA seqDB search
MSNIVIIGSISMDLVMETNRIAKEGETVFGQRFSMVPGGKGANQAVAIGRLSQERDNITI
LGAIGEDSFGPILLDNLNKNHVTTDFVGTIPSSSGVAQITLYNNDNRIIYCPGANGKVDT
KKWSQEWSIIKEADLVVLQNEIPHQANMKIANFCKEHSIKLLYNPAPSRETDIEMLDKVD
YFTPNEHECQELFPNQKLEDILATYPEKLIVTLGTKGAIYSDGKESHLIPALETKAVDTT
GAGDTFNGAFGYAISKKFKIAKALRFATLAAHLSVQKFGAQGGMPTIKEMEDNQHYEKDW
YIK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgtcattatcggtagtatttccatggacttagttatggaaaccaatcgt
atcgccaaagagggagaaaccgtatttggccaacgtttttcaatggttccaggaggtaaa
ggtgctaatcaggctgtcgctattgggcgtcttagccaagagcgagataatattactatt
cttggtgccattggcgaggattcttttggtcccattcttttggataatttaaacaaaaat
catgttactacggattttgtgggaacgataccatcttcttcaggtgttgcccaaatcact
ctttataataatgataatcgaatcatttactgtcctggagccaacggaaaagttgatact
aaaaaatggtctcaggagtggtcaataattaaagaagctgatttagttgtattacaaaat
gaaattcctcatcaagcaaatatgaaaattgctaatttttgtaaagaacatagtattaaa
ttactctataatcctgcaccatctagagagactgatattgagatgctcgataaggtcgat
tatttcacaccaaatgaacacgaatgtcaagagctgttcccaaaccaaaaactagaggat
atattagccacatatcctgaaaaactaatcgtaacactcggcacaaaaggagccatctac
tctgatggaaaagaaagtcatttaattcctgctttagaaactaaagctgttgatacaact
ggtgcaggtgatacttttaacggtgcattcggttatgctatctcgaaaaaatttaagatt
gctaaggccttacgttttgcaactctagctgctcacttatccgtgcaaaaatttggtgca
cagggtggcatgcctacaattaaagaaatggaggacaaccaacattatgaaaaagactgg
tatattaaatag

DBGET integrated database retrieval system