KEGG   Streptococcus agalactiae ILRI112: SAIL_11910Help
Entry
SAIL_11910        CDS       T02705                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00240  Pyrimidine metabolism
sagr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAIL_11910
Enzymes [BR:sagr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAIL_11910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: CCW42208
Position
complement(1107508..1108077)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAV
PISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggaaaacctgtggttattatgacaagcgccttg
gacactcgagatgaatttggagtcgtttcaagtcgtattggaatgcgccgtgaagcagtt
ccaatttcagatgatatggacattttctcctatattcagaatttaccacaaaagccttat
tgtgttttaattgatgaatgtcaatttttgagtaagaaaaacgtctacgatttagctaga
gtagtagatgacttagatgtaccagtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system