KEGG   Streptococcus agalactiae ILRI112: SAIL_15000Help
Entry
SAIL_15000        CDS       T02705                                 

Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAIL_15000
Enzymes [BR:sagr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SAIL_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399593..1401089)
Genome map
AA seq 498 aa AA seqDB search
MKKRASGVLMHITSLPGDLGIGTFGREAYAFVDFLVETDQKFWQILPLTTTSFGDSPYQS
FSAVAGNTHLIDFDLLTLEGFISKDDYQNISFGQDPEVVDYAGLFEKRRPVLEKAVKNFL
QEERATRMLSDFLQEEKWVTDFAEFMAIKEHFGNKALQEWDDKAIIRREEEALAGYRQKL
SEVIKYHEVTQYFFYKQWFELKEYANDKGIQIIGDMPIYVSADSVEVWTMPELFKLDRDK
QPLAIAGVPADDFSDDGQLWGNPIYNWDYHKESDFDWWIYRIQSGVKMYDYLRIDHFKGF
SDYWEIRGDYQTANDGSWQPAPGPELFATIKEKLGDLPIIAENLGYIDERAERLLAGTGF
PGMKIMEFGFYDTTGNSIDIPHNYTENTIAYAGTHDNEVINGWFENLTVEQKAYAENYMR
RLPNEPITETVLRTLYATVSQTTITCMQDLLDKPADSRMNMPNTVGGNWQWRMRKEDLTE
NRKAFLKEITTIYNRGNK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgcaagtggtgtcttgatgcacatcacttctctaccaggtgatttaggt
attggaacatttggacgagaagcctacgcttttgttgattttttggtcgaaactgatcaa
aaattttggcaaattcttcccttaacaacaacaagcttcggggactctccttaccagtct
ttttctgcagtagctggtaatacacatttaattgattttgatttgctaacgcttgaaggt
ttcatttcgaaagatgactaccaaaatattagttttggacaggatccagaagttgttgat
tatgctggtctgtttgaaaaacgccgtccagttttagaaaaagcagttaaaaatttcttg
caagaagagagagcaacgagaatgctatctgatttcttgcaagaagaaaaatgggtaact
gattttgctgaatttatggcgatcaaagaacattttggtaataaggcgcttcaagaatgg
gatgacaaggctattatacgccgcgaagaagaagccttagcaggatatcgtcaaaagctt
agtgaagtgataaaatatcatgaagtaacgcaatatttcttttacaaacaatggtttgag
ttaaaagaatatgctaatgataaagggattcagattatcggtgatatgccaatctacgtt
tctgccgatagtgtagaagtttggacaatgcctgaactgtttaaattagatcgcgacaaa
caaccacttgctattgctggtgtaccagcggatgatttttctgacgatggtcagctttgg
ggcaatcctatttacaattgggattaccacaaagagtcagattttgactggtggatttat
cgtattcaatctggtgttaagatgtatgactatttgcgtattgatcattttaaaggtttt
tcagattattgggaaattcgaggagattatcaaacagctaatgatggctcatggcaacca
gctcccggtccagaattatttgcaactatcaaagaaaaattaggtgatttacctattatt
gctgagaatttaggctatattgatgagagagcagagagattactggctggaacagggttc
ccaggtatgaaaatcatggaattcggtttttatgatacaacaggaaatagtattgatatt
cctcataactacacagaaaatacaattgcatatgctggaactcatgataacgaagttatt
aatggctggtttgaaaatcttacagtcgaacagaaagcttatgcagaaaattacatgcgt
cgtttgccaaatgagcccattactgagactgtactacgtaccttgtatgcaaccgttagt
caaacaacgattacatgtatgcaagacctactagataaacctgcagatagccgtatgaac
atgccaaataccgttggaggtaactggcaatggcgtatgagaaaagaagacttaacagaa
aatcgcaaagcattcttaaaagagattacaactatttataatagagggaataaataa

DBGET integrated database retrieval system