KEGG   Streptococcus agalactiae ILRI112: SAIL_17300Help
Entry
SAIL_17300        CDS       T02705                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00220  Arginine biosynthesis
sagr00250  Alanine, aspartate and glutamate metabolism
sagr00290  Valine, leucine and isoleucine biosynthesis
sagr01100  Metabolic pathways
sagr01110  Biosynthesis of secondary metabolites
sagr01130  Biosynthesis of antibiotics
sagr01210  2-Oxocarboxylic acid metabolism
sagr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sagr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAIL_17300
   00290 Valine, leucine and isoleucine biosynthesis
    SAIL_17300
   00220 Arginine biosynthesis
    SAIL_17300
Enzymes [BR:sagr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SAIL_17300
    2.6.1.66  valine---pyruvate transaminase
     SAIL_17300
Amino acid related enzymes [BR:sagr01007]
 Aminotransferase (transaminase)
  Class I
   SAIL_17300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cor1
Motif
Other DBs
NCBI-ProteinID: CCW42742
Position
complement(1615012..1616223)
Genome map
AA seq 403 aa AA seqDB search
MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAAFGFEAPDEVIRDLIT
NARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVSEGISMSMQALLDNDDE
VLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPT
GAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPIASIAEDIFTVTLSGLSKS
HRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLAQQVIQTSLGGQQSIDSMLL
PGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTDMYRIDNDEEFVLNFLKQEKV
LLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLSQYKR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttgataaatcaatgaagctggaacatgtggcttatgatattagaggccct
gttttagaagaggcagaccgcatgagggcaaatggtgaaaagatattgcggttaaatact
ggaaatccagctgcctttggcttcgaagcgccagatgaagtcattcgtgatttaattacg
aatgcgcgtgaatcagaaggatactctgattcgaaaggtattttttcagcccgtaaggct
gttatgcagtattaccagttacaaaacatccatgttgacatggatgatatatacattgtt
aatggtgttagtgagggaatctctatgtcaatgcaagctttgcttgataatgatgacgag
gttctagttccaatgccagattacccgttatggacagcttgtgttagccttgctggagga
aatgctgtgcattatatttgtgatgaggaagctaattggtatcctgatattgatgatatc
aaatcaaaaatcacatccaaaacaaaagcaatcgtcctcattaatccaaataatccaact
ggagcagtctatccgcgtgaaattctgcaagagattgtggatatcgctagacaaaatgac
ttgattattttttcagacgaggtttatgaccgtttagttatggatggaatggagcatatc
ccaattgcttctattgcagaggatatttttacagttactttatctggcttatctaaatca
catcgcatctgtggtttccgcgttggttggatggtattgtctggtccgcgacaacatgtt
aaaggttatattgaaggtttgaatatgttagctaacatgaggctgtgttcaaatgttctt
gctcaacaggttattcaaacatcgttaggcggacagcaatctattgatagtatgttgttg
ccaggaggtcgtatctacgagcaacgtaattatatccataaagcaattaatgaaatacct
ggtttatctgctgtaaaaccaaatgctggactgtatcttttccctaaaattgatacagat
atgtaccgtattgataatgatgaagagtttgtgcttaatttcttaaaacaagaaaaagta
ttactaacacacggtagaggatttaatatgaataccgctgaccattttagaattgtttac
ttaccacgtgttgatgaattgactgaactacaagaaaaaatggctcgctttttaagccaa
tacaagcgctag

DBGET integrated database retrieval system