KEGG   Streptococcus agalactiae SA20-06: SaSA20_0054Help
Entry
SaSA20_0054       CDS       T02338                                 

Gene name
adhP
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00010  Glycolysis / Gluconeogenesis
sags00071  Fatty acid degradation
sags00625  Chloroalkane and chloroalkene degradation
sags00626  Naphthalene degradation
sags01100  Metabolic pathways
sags01110  Biosynthesis of secondary metabolites
sags01120  Microbial metabolism in diverse environments
sags01130  Biosynthesis of antibiotics
sags01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaSA20_0054 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SaSA20_0054 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SaSA20_0054 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SaSA20_0054 (adhP)
   00626 Naphthalene degradation
    SaSA20_0054 (adhP)
Enzymes [BR:sags01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SaSA20_0054 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Methyltransf_31 FtsJ MTS ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AFV71546
UniProt: A0A2I6USU0
Position
223127..224143
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILSHE
GIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIAVYGAGGLGNLAVQ
YAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAAYIQEKTDGCHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgttgttaatcaagctagtacaggtgttgaagttgttgagcatgatctt
ccaaaagttggtcatggtgaagcacttgtaaaagtagaatactgtggtgtgtgccatact
gatttacacgttgcacatggagatttcggccaggtaccaggacgcattttgagtcacgaa
ggcattggtatagtagaagaaattggagaaggcgtaacgtctttgagggttggtgatcgt
gtctctattgcatggttctttgaagggtgcggtcattgcgaatactgtactacaggacgt
gagacgctttgtcgtagtgttaaaaatgctggatacagtgttgatggtggtatgagtgaa
tacgctattgtcaccgcggactatgcggttaaggttcctgagggattagacccagctcaa
gcatcatcaatcacttgtgctggagtaacaacatacaaggctatcaaagaagctggagct
gctcctggtcagtggattgcagtgtatggtgcaggtggtcttggaaacttagcagtccaa
tatgcaaaaaaagtattcaatgctcatgttgtagctgttgatattaacgcagataaactt
caattagctaaagaagttggagcagatttgacagttaatggcaaagaaataaaagatgtt
gcggcatatattcaagaaaagacagacggttgtcatggagtggttgtgactgctgtttct
aaagttgcgtttaatcaggcgattgatagcgttcgtgctggaggtacagtggtagctgtt
ggtcttccatcagaatatatggaattgagtattgtaaaaacagtacttgatgggattcgc
gtggttggttccttagttggaactcgtaaagacttagaagaagccttcgcatttggagca
gaaggcttggtagtaccggtggttgaaaaagtgcctgtggatacagctcctcaagtattc
gatgaaatggaaagaggattgattcaaggacgtaaagttcttgactttacaaagtga

DBGET integrated database retrieval system