KEGG   Streptococcus agalactiae SA20-06: SaSA20_0054Help
Entry
SaSA20_0054       CDS       T02338                                 

Gene name
adh
Definition
Alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SaSA20_0054 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaSA20_0054 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SaSA20_0054 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SaSA20_0054 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SaSA20_0054 (adh)
   00626 Naphthalene degradation
    SaSA20_0054 (adh)
Enzymes [BR:sags01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SaSA20_0054 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72069..73085
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILSHE
GIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIAVYGAGGLGNLAVQ
YAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAAYIQEKTDGCHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgttgttaatcaagctagtacaggtgttgaagttgttgagcatgatctt
ccaaaagttggtcatggtgaagcacttgtaaaagtagaatactgtggtgtgtgccatact
gatttacacgttgcacatggagatttcggccaggtaccaggacgcattttgagtcacgaa
ggcattggtatagtagaagaaattggagaaggcgtaacgtctttgagggttggtgatcgt
gtctctattgcatggttctttgaagggtgcggtcattgcgaatactgtactacaggacgt
gagacgctttgtcgtagtgttaaaaatgctggatacagtgttgatggtggtatgagtgaa
tacgctattgtcaccgcggactatgcggttaaggttcctgagggattagacccagctcaa
gcatcatcaatcacttgtgctggagtaacaacatacaaggctatcaaagaagctggagct
gctcctggtcagtggattgcagtgtatggtgcaggtggtcttggaaacttagcagtccaa
tatgcaaaaaaagtattcaatgctcatgttgtagctgttgatattaacgcagataaactt
caattagctaaagaagttggagcagatttgacagttaatggcaaagaaataaaagatgtt
gcggcatatattcaagaaaagacagacggttgtcatggagtggttgtgactgctgtttct
aaagttgcgtttaatcaggcgattgatagcgttcgtgctggaggtacagtggtagctgtt
ggtcttccatcagaatatatggaattgagtattgtaaaaacagtacttgatgggattcgc
gtggttggttccttagttggaactcgtaaagacttagaagaagccttcgcatttggagca
gaaggcttggtagtaccggtggttgaaaaagtgcctgtggatacagctcctcaagtattc
gatgaaatggaaagaggattgattcaaggacgtaaagttcttgactttacaaagtga

DBGET integrated database retrieval system