KEGG   Streptococcus agalactiae SA20-06: SaSA20_0055Help
Entry
SaSA20_0055       CDS       T02338                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00260  Glycine, serine and threonine metabolism
sags00750  Vitamin B6 metabolism
sags01100  Metabolic pathways
sags01110  Biosynthesis of secondary metabolites
sags01120  Microbial metabolism in diverse environments
sags01230  Biosynthesis of amino acids
Module
sags_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SaSA20_0055 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SaSA20_0055 (thrC)
Enzymes [BR:sags01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SaSA20_0055 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF4252
Motif
Other DBs
NCBI-ProteinID: AFV71547
UniProt: A0A2I6YU99
Position
224263..225753
Genome map
AA seq 496 aa AA seqDB search
MAIVYQSTRDASNKVTASQAILKGLADDGGLFTPITFPKVDLDFTKLKDASYQEVAKLVL
SAFFDDFTEQELDCCISQAYDVKFDTTEIAPIVKIGDRYHLELFHGPTIAFKDMALSILP
YLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKNGVSYIQELQMI
TQAGQNTHVVAIEGNFDDAQTSVKEMFNNSLLRSKLSQQHMQLSSANSMNIGRLVPQIVY
YIYAYAQLVKSKEISIGQPINFSVPTGNFGNILAAYYASQIGLPVTKLICASNDNNVLTD
FFKTQTYDKNREFKVTSSPSMDILVSSNLERLIFHLLGDDAETTKKLMEDLVTTGEYALE
ARQANILESFVAGFATEQFVELDIKRLFDQYQYIEDPHTAVASAVYQAYQTETKDQTPTV
IVSTASPYKFPCVVTKAITNKEEIQDFAAISILNDLSGVSLPRAVTDLQKAEVIHRTVVP
TSNMRETVEECLGLKQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtatatcaatcaacacgtgatgctagtaataaagtgacagctagtcaagcg
attctaaagggattagctgacgatggaggactctttacccccatcacatttccaaaagtt
gatttagatttcactaaacttaaggatgcttcctatcaagaagtggctaaactcgttttg
tcagctttttttgatgattttactgaacaagaattggattgctgtattagtcaagcttat
gatgttaaatttgatacaactgaaatagccccgatagtaaagattggagaccggtatcac
cttgaattatttcacggtcctacaattgcatttaaagatatggctttatctattcttcct
tatttgctaacaacagcagccaaaaaacaaggggttgataataaaatcgttattttaaca
gcaacatcaggtgacactggcaaggcagcgatggcaggttttgcagatgttccaggaact
gagattattgtcttttatcctaaaaatggtgttagttatatccaagaattgcagatgata
acacaagccggacaaaatacccatgttgttgcgattgaaggaaattttgatgatgcacag
acttcagttaaagaaatgttcaataattcccttcttcgatcaaaattatcacagcagcat
atgcagttatcatcagctaattcaatgaacatcggtcgccttgttcctcaaattgtttac
tatatatatgcatatgctcaattagttaagtcaaaggaaatctcaattggtcaaccaatt
aattttagtgtacctacaggaaattttggtaatattttagcagcatattatgctagtcaa
attggattacctgttaccaaactcatttgtgcctcaaatgataataacgttctaacagat
ttttttaagacacaaacctacgataaaaatcgagaatttaaagtgacatcaagtccctct
atggatattttagtctcctctaatctagaacgattaatctttcaccttttaggcgatgat
gcagaaacgactaaaaaattaatggaagatttagtgactactggggagtatgccttagaa
gctaggcaagcaaatattttagagagctttgtagcgggatttgcgacagaacaatttgtt
gaattagacatcaaacgtttatttgaccagtatcagtatatagaggatccgcatacagct
gtagcatcagctgtttaccaagcttatcagacagaaactaaagatcaaactccaacagta
attgtgtcgacagcaagtccttataagttcccgtgtgttgttacaaaggctattacaaat
aaagaagagatacaggatttcgctgctatttcaatcttaaacgatttgtcaggtgtttct
ttacctagggcggttacagatctacaaaaggccgaagtaatccatagaacggtagtacct
acctcaaatatgcgagaaacggttgaagagtgtctaggtttgaaacaataa

DBGET integrated database retrieval system