KEGG   Streptococcus agalactiae SA20-06: SaSA20_0111Help
Entry
SaSA20_0111       CDS       T02338                                 

Gene name
gltX
Definition
glutamate--tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sags00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
122941..124395
Genome map
AA seq 484 aa AA seqDB search
MANKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLELYQRYIDQLLAEGKAYKSYVTEEELAAERERQE
LAGETPRYINEFIGMSETEKEAYIAEREASGIIPTVRLAVNESGIYKWTDMVKGDIEFEG
SNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPQ
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMSEAVFNFIALLGWNPGGEEEIFSR
EQLINLFDENRLSKSPAAFDQKKMDWMSNDYLKNADFESVFALCKPFLEEAGRHTDKAEK
LVELYKPQLKSADEIVPLTDLFFADFPELTEAEKEVMAAETVPTVLSAFKEKLVSLSDEE
FTRDTIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGKEKSVQHIDNM
LAKL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagattcgtgtgcgttatgcaccaagtccaacaggattgttacacatcgga
aatgcgcgtactgcgctctttaactacctttatgctcgccatcatggtggggattttgtt
attcgtattgaagatactgaccgaaaacgtcacgtcgaagatggtgaacgctctcaattg
gagaacttacgttggctaggtatggactgggatgaaagccctgaaacacatgaaaattat
cgtcaatcagaacgccttgagctctaccaacgttatattgatcagttgttagcagaaggt
aaagcctacaagtcctatgtgactgaggaagaattagcagcagagcgtgaacgccaagaa
ttggcaggcgaaacacctcgctatatcaacgaatttatcggaatgtcagaaactgaaaaa
gaagcttacattgcagaacgtgaagcatcaggcatcattccgacagtacgccttgctgtt
aatgaatctgggatttataaatggactgatatggtaaaaggtgacattgagtttgaaggc
tctaatatcggcggagactgggttattcagaagaaagatggttatccaacttacaatttc
gcagtagtcattgatgatcatgacatgcaaatttcgcatgttattcgtggcgatgaccat
attgcaaatacgccaaaacaattaatggtttatgaagcactcggttgggaagcgccacaa
tttggtcacatgacattgattataaactcagagactggtaagaaattatcaaaacgcgac
accaatactcttcaatttatcgaagactatcgtaaaaaaggttatatgtcggaagctgtc
tttaatttcattgcccttcttggctggaaccctggtggagaagaagaaatcttctcacgc
gagcaattaattaatctatttgatgaaaatcgtcttagcaaatcaccagcagcattcgat
cagaagaagatggattggatgagtaatgattacctaaaaaatgctgattttgagagtgtt
tttgcactttgcaaaccattcttagaagaagctggtcgacatacagacaaagctgaaaaa
ttagttgagctttataaacctcagttaaaatcagctgatgagattgtaccattaacagac
cttttctttgcagattttccagaattaacagaagccgaaaaagaagtaatggcagcagaa
acagtcccaacagtcttatctgcttttaaggaaaagttagtatcgctttctgacgaagaa
ttcactagagatactattttccctcaaattaaggctgttcaaaaagaaacaggtatcaaa
ggtaagaacctatttatgcctattcgtattgcggtttctggtgaaatgcatggaccagag
ttaccagatactatttatttattaggtaaagaaaaatcagttcaacatattgataatatg
ttagcaaaattataa

DBGET integrated database retrieval system