KEGG   Streptococcus agalactiae SA20-06: SaSA20_0255Help
Entry
SaSA20_0255       CDS       T02338                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00330  Arginine and proline metabolism
sags00332  Carbapenem biosynthesis
sags01100  Metabolic pathways
sags01130  Biosynthesis of antibiotics
sags01230  Biosynthesis of amino acids
Module
sags_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SaSA20_0255 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SaSA20_0255 (proB)
Enzymes [BR:sags01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SaSA20_0255 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFV71743
UniProt: A0A2I6XFE0
Position
53979..54782
Genome map
AA seq 267 aa AA seqDB search
MKRHFETTRRIVIKVGTSSLVQTSGKINLSKIDHLAFVISSLMNKGMEVILVSSGAMGFG
LDILKMDKRPQEISQQQAVSSVGQVAMMSLYSQIFSHYQTHVSQILLTRDVVVFPESLQN
VTNSFESLLSMGILPIVNENDAVSVDEMDHKTKFGDNDRLSAVVAKITKADLLIMLSDID
GLFDKNPNIYDDAVLRSHVSEITDDIIKSAGGAGSKFGTGGMLSKIKSAQMVFDNNGQMI
LMNGANPRDILKVLDGHNIGTYFAQGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacattttgagacaactagaagaattgttattaaagtaggaaccagttccctc
gtacagacaagcgggaaaattaatttaagtaaaatagaccatttagcatttgttatttct
agtcttatgaataaaggtatggaggtgattttagtatcatctggagctatggggtttggt
ttagacattttgaaaatggataagcgtcctcaagaaatatcacaacaacaagcagtttct
agcgtagggcaagtagccatgatgagtctttattctcagatattttcgcactatcaaact
catgtttcccaaattttattaacacgtgacgttgtggtttttccagagagtttgcaaaat
gtaacaaactcttttgagagtctgctctctatgggaattttgccaatcgtcaatgagaat
gatgctgtcagcgtggatgagatggatcataaaacgaagtttggggataatgaccgtctc
tctgctgtcgttgctaaaattactaaagcagatttattaattatgctgtcagatattgat
ggtctttttgataaaaatcctaatatttatgatgatgctgttttacgtagtcatgtttct
gagatcaccgatgacatcatcaagtcagctggaggagcaggaagtaagtttggtactggt
ggtatgcttagtaaaattaaaagtgcacaaatggtgtttgataacaatggacaaatgata
ttgatgaatggcgccaatcctcgtgatattttaaaggtgttagatgggcataatattgga
acttattttgctcaaggaaagtga

DBGET integrated database retrieval system