KEGG   Streptococcus agalactiae SA20-06: SaSA20_0415Help
Entry
SaSA20_0415       CDS       T02338                                 

Gene name
agaR
Definition
alpha-galactosidase 1
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SaSA20_0415 (agaR)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SaSA20_0415 (agaR)
   00600 Sphingolipid metabolism
    SaSA20_0415 (agaR)
Enzymes [BR:sags01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SaSA20_0415 (agaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436229..438430
Genome map
AA seq 733 aa AA seqDB search
MPINFREKEKEFHLYNDSLSYVICVLPNGHIGNLYYGKRLSENMSYAYLLENKYRPLTAY
VYEDDDCFSLQHTRQEYASYGSGDMILPAFEISHEDGSHLSHFVFYDYAISKGKPQLSGL
PNTYVESDEEATSLELYLKDHNSETELCLTYTIYESRAVITRNAKFTQRGETELCLKRAL
SLCLDLPDKDYEWLHLDGAWGRERYLQSSLLHQGSQSIYSLKGASSAEHNPFIALKRPDA
NEHEGEVMGFSLVYSGNFLAQVDVTPFHQTRVSMGIHPLGFEWYLKSGESFQTPEVVMVY
SRLGLNGMSQTYHDLFSQRLARGEWRDRERPILLNNWEAMTFNFDENSILSLAEVAAKLG
VELFVMDDGWFGQRNNEKAGLGDWRVNQKKLPNGLLGVSQRIHQLGMLFGLWIEPEMVNK
DSDLYREHPDWILHHPKHSQSQGRHQYTLDLSREEVYQNIYQQLHDLLANHGIDYIKWDM
NRYMTEAYSYHATKEHQGAIFHRYILNLYRLYETLTSEFPHILFESCSSGGARFDPGMLY
YAPQTWTSDDTDAYERLKIQYGTSLVYPLITMGNHVSEVPNQQLLRTTPLSTRANVAYFG
SFGYEIDLMLLEEEELELIKKEIDFYKNYRRVFQFGNFTRLINPFETDDAAWQVISEDGH
HVFVGLYLGLLKLNGPSYHRLHLKGLEAEASYRLNNQVYLGSALMNAGLVINEKDFTEGY
KDFASAIYHLEKM
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaattttcgtgaaaaagaaaaagaatttcatctctataatgacagcctcagt
tatgttatttgtgtcttgccaaatgggcatattggaaatctttattatgggaaacgatta
tcagaaaatatgtcctatgcttatttattagaaaataaatatcgaccacttacagcctat
gtctatgaagatgatgattgtttttcattacaacatacgcgtcaagaatatgcttcttat
ggcagtggagatatgattttaccagcttttgaaattagtcatgaagatggtagtcattta
tcacattttgttttttatgattatgctatttcaaaggggaagcctcaattatctggtttg
cctaatacctatgtagaatctgatgaggaagcaactagtctggagctttatttaaaggat
cataatagtgaaacagaactttgtttaacttataccatctatgagagtagagctgttatc
acaagaaatgctaaatttacccaaagaggcgaaacagagctttgtttaaaaagagccctt
agcctttgcctagacttacctgataaggattatgaatggcttcatttagatggtgcttgg
ggtagggaacgttacctacaaagttcgctattacatcaagggagccaatcaatttacagt
ttaaagggtgctagtagtgccgaacataatccttttatagctttaaaaagacccgatgca
aatgagcatgagggagaagtaatgggcttttccttagtatatagtggaaattttttagca
caggttgatgtgacaccatttcatcaaactagagttagtatggggattcatccgttagga
tttgaatggtatttaaagtcaggagaaagtttccaaacccctgaggttgttatggtttac
agtcgtttaggattgaatggcatgagtcaaacctatcacgacttatttagccaacgtttg
gctagaggagaatggcgtgatagagaacggcctattcttcttaataattgggaagctatg
acatttaattttgatgaaaattccattttaagcttagctgaagtagctgctaagcttggt
gtagaactttttgttatggatgatggctggtttggtcaaaggaataatgagaaggctggc
cttggagattggcgtgtgaatcaaaaaaaacttcccaatggtttacttggtgttagtcag
agaatccatcagttagggatgttatttggtttgtggattgaaccagagatggtcaacaaa
gatagcgatctctaccgagaacatcctgattggattttacatcatcctaagcattcacaa
tctcaaggacgccaccagtatacactagatttgtctcgggaagaggtatatcaaaatatt
tatcaacagttacatgatctgttagctaatcatggtattgactatataaaatgggacatg
aatcgttatatgacggaggcttacagctatcatgcgactaaagagcatcaaggagcaatc
tttcatcggtatatcctaaacctttaccgactatatgagacgttaaccagtgagtttcca
catattctatttgagtcatgctctagtggtggagcaaggtttgatccaggaatgctttat
tatgctccgcaaacatggactagcgacgatacggatgcttatgaacgtctaaaaattcag
tatggtacaagtctggtttatcctcttataactatgggaaatcatgtttcggaggttcca
aatcaacaactcttacgtaccacaccgctttctacaagagctaatgtagcttattttgga
agttttggatatgagattgacttaatgcttcttgaagaagaggaattagagctaatcaaa
aaagagattgatttttacaaaaattatcggagagtcttccaatttggtaattttacgcgt
ctaattaatccgtttgaaactgatgatgctgcttggcaagtcatctcagaagatggacat
catgtttttgtaggtctctatttaggtttgctaaaactaaatggtccttcttatcaccgt
ttacacttaaaaggtttagaagcagaagcaagttatcgtttaaataatcaagtctatcta
ggaagtgccttgatgaatgctggcttggttatcaacgaaaaagacttcacagagggctat
aaagattttgcatcagctatataccatttagaaaagatgtaa

DBGET integrated database retrieval system