KEGG   Streptococcus agalactiae SA20-06: SaSA20_0453Help
Entry
SaSA20_0453       CDS       T02338                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SaSA20_0453 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SaSA20_0453 (atoB)
   00640 Propanoate metabolism
    SaSA20_0453 (atoB)
   00650 Butanoate metabolism
    SaSA20_0453 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SaSA20_0453 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SaSA20_0453 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SaSA20_0453 (atoB)
   00310 Lysine degradation
    SaSA20_0453 (atoB)
   00380 Tryptophan metabolism
    SaSA20_0453 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaSA20_0453 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SaSA20_0453 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SaSA20_0453 (atoB)
Enzymes [BR:sags01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SaSA20_0453 (atoB)
Exosome [BR:sags04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaSA20_0453 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
472483..473598
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTTTEKLLTETPTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacggttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaacg
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaaggttgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcatgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacgactacggaaaaactattaacagaaactcctactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system