KEGG   Streptococcus agalactiae SA20-06: SaSA20_0665Help
Entry
SaSA20_0665       CDS       T02338                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00010  Glycolysis / Gluconeogenesis
sags00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaSA20_0665 (bglA)
   00500 Starch and sucrose metabolism
    SaSA20_0665 (bglA)
Enzymes [BR:sags01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SaSA20_0665 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AFV72133
UniProt: A0A2I6UYS9
Position
697519..698946
Genome map
AA seq 475 aa AA seqDB search
MTIFPKHFLWGGAVAANQVEGAFRTDGKGLSIQDALPNGGLGDFTAKPTPDNLKLEAIDF
YHNYKNDIKLFAEMGFKVFRTSIAWSRIFPNGDDSAPNEAGLQFYDNLFDELLKYNIEPL
VTLSHYETPLHLAKTYNGWADRRLIAFFEKFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGAIMTDKSQLSPQELYQAIHHELVASARVTKLGRSINPNFKIGCMILAMPAYPMTSDP
RDVLAARQFEQHNLLFSDIHVRGKYLTYIQSYFKNNGIKIKFEEGDEEVLAQNTVDFLSF
SYYMSVTQAYDFENYQSGQGNILGGLTNPHLTTSEWGWQIDPIGLRLVLNQYYERYQIPL
FIVENGLGAKDQLIETLDGDYTVEDDYRIDYMNQHLVQVAKAIEDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGTGSLQRYKKKSFGWYQKVIRTNGQSLFEHHNR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttttcctaaacattttctatggggaggtgcagttgctgccaatcaggtagag
ggtgcatttagaacagatggcaaaggtttatctatacaagatgcacttccaaatggtggt
ctaggcgattttaccgccaaacctactccagacaatttgaagctagaagcaattgatttt
tatcataactataaaaatgatataaaactgtttgcagagatgggctttaaagtttttaga
acctctattgcctggtctcgaatttttccaaatggtgatgatagtgctccaaacgaagct
ggcttacaattttatgataatttatttgacgagttgcttaaatataatatcgagcccttg
gttaccttatctcattatgaaacaccgcttcatcttgcaaagacctataatggttgggct
gatagacgtttgatagcattttttgagaaatttgctcaaacagtcatggagcgttataaa
gataaggtgaaatattggttgacttttaatgaagtgaattctattttacatatgcctttc
accagtggtgctattatgaccgacaaatcacaactaagtcctcaggagctttatcaagct
attcatcatgaattagtagcatcggctagagtgacaaaattagggcgttctatcaaccct
aattttaaaattggctgtatgattctggctatgccagcttatcctatgacatctgatcca
agagatgtcctggctgcaagacaatttgaacaacataatctgctattttcagatatacat
gtcagaggtaaatatctcacttatattcagtcttatttcaaaaataatggtattaaaatt
aaatttgaagaaggagatgaggaagtattggcacaaaatacagtagattttctatcgttt
agttactatatgagtgtgacacaagcttatgactttgaaaattatcaaagtggtcaggga
aatatccttggaggcctgactaatcctcatttaacaacttcagaatggggatggcaaatc
gatcccatcgggctacgcctagtattaaatcagtattatgaacgttatcagattccgttg
tttattgtagaaaatggattgggagcaaaagatcaattgatagaaacactagacggtgat
tatactgtcgaagatgattatcgtattgattatatgaatcaacatttagttcaagttgct
aaagctattgaagatggtgttgaaataatgggatatacatcttggggatgtattgattgt
gtatccatgtctacagctcaactaagtaaacgttatggtctaatatatgttgatcgaaat
gatgatggaacagggagtctacaacgttacaagaagaagtcatttggttggtaccaaaaa
gtgattaggacaaatggtcaatcattgtttgaacatcataacagataa

DBGET integrated database retrieval system