KEGG   Streptococcus agalactiae SA20-06: SaSA20_0718Help
Entry
SaSA20_0718       CDS       T02338                                 

Gene name
murA1
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00520  Amino sugar and nucleotide sugar metabolism
sags00550  Peptidoglycan biosynthesis
sags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SaSA20_0718 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SaSA20_0718 (murA1)
Enzymes [BR:sags01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SaSA20_0718 (murA1)
Peptidoglycan biosynthesis and degradation proteins [BR:sags01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SaSA20_0718 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFV72184
UniProt: A0A2I6UZ28
Position
751256..752515
Genome map
AA seq 419 aa AA seqDB search
MRKIIINGGKQLTGEVAVSGAKNSVVALIPATILADDIVVLDGVPAISDVDSLVDIMETM
GAKIKRYGETLEIDPRGVKDIPMPYGKINSLRASYYFYGSLLGRYGQATVGLPGGCDLGP
RPIDLHLKAFEAMGASVSYEGDSMRLATNGKPLQGANIYMDTVSVGATINTMIAAAKANG
RTVIENAAREPEIIDVATLLNNMGAHIRGAGTDVITIEGVKSLHGTRHQVIPDRIEAGTY
IAMAAAIGRGIKVTNVLYEHLESLIAKLDEMGVRMTVEEDSIFVEEQEKLKAVSIKTSPY
PGFATDLQQPLTPLLLTAEGNGSLLDTIYEKRVNHVPELARMGANISTLGGKIVYSGPNQ
LSGAPVKATDLRAGAALVIAGLMAEGRTEITNIEFILRGYSNIIEKLTSLGADIQLVEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaattattattaacggtggcaagcaactgacgggagaagttgctgtatcgggt
gccaaaaatagtgtagttgccttgattcctgccactatccttgctgatgatattgtggtc
ttagatggagttccggctatttctgacgttgacagtttagttgacattatggaaactatg
ggagctaagattaagcgttatggtgagacgcttgaaattgatccacgtggcgttaaagat
attccaatgccttatggcaaaatcaatagtcttcgtgcatcctattatttctatggaagc
ttattggggcgttatggtcaagcaacagtaggtttacctggtggttgtgatttaggcccc
cgtccgattgatttacatttaaaagcttttgaagcaatgggagctagtgtttcttatgaa
ggtgattcaatgcgtctagcaacaaacggaaagcctttgcaaggagcaaatatttatatg
gatactgtcagtgttggtgcgacaattaacactatgatcgcagcagctaaggcaaatggt
cgtacggttattgaaaatgctgcacgtgaaccagaaattattgacgtggctactctttta
aataatatgggagctcatattcgtggtgctggaactgatgttattacaattgaaggtgtg
aaatcgctccatggcacgcgtcatcaagtaattccagatcgtattgaagcaggaacttat
attgctatggcagcagctatcggacgaggaataaaagtgaccaatgtgttatatgaacac
cttgagagtctcattgctaagttagatgagatgggagttcgaatgacagttgaagaggat
tcaatttttgtcgaagaacaagaaaagttaaaagctgtatccataaaaacctcaccttac
ccaggatttgctacagatttacaacaacctctaacccctttattactaacagcagaagga
aacgggagtttattagatactatctatgagaaacgtgtcaatcatgttcccgaattagca
cgtatgggagctaatatttctaccctagggggcaaaatcgtttatagtggtcctaatcaa
ttatctggtgcacctgtaaaagcgacagatttgcgtgcaggcgctgctttagttatcgct
ggcttaatggcagagggacgaactgaaattacgaacatcgagtttattttacgtggatat
tctaatatcatcgagaaactaacatcattgggtgcggatatccaattggttgaggaatag

DBGET integrated database retrieval system