KEGG   Streptococcus agalactiae SA20-06: SaSA20_0728Help
Entry
SaSA20_0728       CDS       T02338                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SaSA20_0728 (glgB)
Enzymes [BR:sags01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SaSA20_0728 (glgB)
Exosome [BR:sags04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaSA20_0728 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755354..756898
Genome map
AA seq 514 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENESFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWEANSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYKERRPGTASVIKVLRNKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDCLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGALNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEVVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQF
LEWKYNDQLEWGNLNDDMNQKMQRYTKQLNQFYKDYKCLWRIDDSFDGLEIIDADNKSET
VLSFIRKDDKGDLLLCVFNMTPVERPNFTIGVPRAGIYEEVLNTEMEEFGGVWKNHNPVT
KTQVATWKDYDHTLSFTLPALGASVWRIKRRLRK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatgaaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgccctctccaaatgaac
aaaaatcaagcaggagtttgggaagctaacagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tataaggaaagacgtcctggaactgcaagtgttattaaagttcttagaaataaaaagtgg
gaagatggcctttggatgggaaggcgcaaacgtctgggttttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagactgcttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtggaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgat
gatgctttagcttatttcgatggaactgctacttatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggagctctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttattctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaagtagtacatggtaaaaagagtatg
atgcataaaatgtggggtgaccgttataatcaatttgctggtttacgtaatttatatgca
tatcaaatgtgtcatcctgggaaaaaacttctctttatgggaagtgagttcggtcaattt
ttagaatggaaatataatgatcaactagaatggggaaacttaaatgatgatatgaaccaa
aagatgcaacgctatactaaacaattgaatcaattttataaagattataagtgcctatgg
cgtattgatgattcttttgacgggctagaaattattgatgcggataataaatctgaaact
gttttatcttttatacgaaaagatgataaaggcgatttattactttgtgtctttaatatg
actcctgtagaacgccctaactttactattggtgttccgcgagcgggtatttatgaagaa
gttttaaatactgaaatggaagagtttggaggtgtttggaaaaaccacaatcctgtaacg
aaaacacaagtggctacatggaaagattatgatcatactttaagttttacattaccagcc
cttggggcaagtgtttggagaataaaacgtcggcttcgtaaataa

DBGET integrated database retrieval system