KEGG   Streptococcus agalactiae SA20-06: SaSA20_0741Help
Entry
SaSA20_0741       CDS       T02338                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sags00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sags00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767643..768914
Genome map
AA seq 423 aa AA seqDB search
MDKIIVEGGQTRLQGQVVIEGAKNAVLPLLAATILPSQGKTLLTNVPILSDVFTMNNVVR
GLDIQVDFNCDKKEILVDASGDILDVAPYEFVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGATITQNGGDITAQAEKLKGANIYMDFPSVGATQNLMMAATLA
SGTTTIENAAREPEIVDLAQLLNKMGAKVKGAGTETLTIIGVDALHGTEHDVVQDRIEAG
TFMVAAAMTSGNVLVKDAIWEHNRPLISKLMEMGVEVSEEEDGIRVKADTKKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMIETVFENRFQHLEEMRRMGLQTEILRDTAMIHG
GRALQGAPVMSTDLRASAALILAGIVAQGETVVGQLTHLDRGYYQFHEKLAALGANIKRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtggaaggtgggcaaacgcggcttcaaggtcaagttgttattgaa
ggagctaaaaatgcagttttacctcttttagcagccacaattttaccaagccaagggaaa
acattattgaccaatgttcctatcttgtctgatgtatttacaatgaacaatgttgttcgt
ggtttagatattcaagttgactttaattgcgataaaaaagaaatcttagtggatgcctca
ggtgatattttagatgttgcaccgtatgaatttgttagtcaaatgagagcttctattgtt
gttttgggacctattttagctagaaatgggcatgctaaggtttcaatgccaggcggttgt
acaattggtagccgaccaattgaccttcatcttaaaggtttagaagctatgggagctacg
attacacaaaatggtggtgatattactgcccaagctgaaaagcttaagggagctaatata
tacatggattttccctcagtcggtgccactcaaaacttaatgatggctgctacacttgct
tcaggcacaacaacgatagagaatgctgcacgtgaaccagaaattgtagaccttgcgcag
ttactaaataaaatgggagctaaagtaaagggtgctggtacggaaacattaacgatcatt
ggtgttgatgctttacatggtacagaacatgatgttgtccaagatcgtattgaagctgga
acctttatggtggcagctgctatgacttctggaaatgttctagtaaaggatgctatttgg
gaacataaccgccctttaatctctaaattgatggagatgggtgttgaagtgtcagaggaa
gaagatggtattcgtgtaaaagctgatactaaaaaattgaagccagtgactgtgaaaaca
cttcctcatccaggatttcctactgatatgcaagctcaatttacagctctaatggcagta
gttaatggcgaatcaactatgattgagacagtttttgaaaatcgttttcaacatttggaa
gaaatgcgtcgcatgggattacaaacggaaattttacgagacactgcaatgattcatggt
gggagagccttacaaggtgcaccggtcatgtctactgacttacgagctagtgcagcttta
atcttggcaggaattgttgcgcaaggggaaacagtagttggccaattaacccatttagac
cgtggttattatcaattccatgaaaaattagcggctcttggtgctaatattaaacgtgta
agtgaggcgtaa

DBGET integrated database retrieval system