KEGG   Streptococcus agalactiae SA20-06: SaSA20_0759Help
Entry
SaSA20_0759       CDS       T02338                                 

Definition
Mur ligase, central
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sags00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sags00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(794240..795583)
Genome map
AA seq 447 aa AA seqDB search
MKINTALGVAAGKSAHYLLSKMGRGSTYPGSLALKFDKDILDTIAKDYEIVVVTGTNGKT
LTTALTVGILKKAFGQVVTNPSGANMITGIVSTFLTAKKSKSGKKIAVLEIDEASLPRIT
QYIKPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAANAPQATILANGDSPLFNSKSVTNP
VQFYGFDTDKHEPRLAHYNTEGILCPKCQAILTYRLNTYANLGDYTCPNCGFERPNLDYA
LTRLTHLTNTSSGFVIDGQQYNINVGGLYNIYNALAAVSVAEYFGVEPSQIEDGFDKSRA
VFGRQETFTIGNKKCTLVLIKNPVGASQALDMIKLAPYPFSLSVLLNANYADGIDTSWIW
DANFETILTMNIPEIFAGGVRHSEIARRLRVTGYDEKRIKQADKLQDIMTMIEQQETEHA
YILATYTAMLEFRKILANHNAIRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagcactaggagtggctgccggtaagtctgctcattaccttttaagt
aaaatgggacgtggctctacttatccgggtagtttagcactcaaattcgataaagatata
ctagatacaattgccaaagattatgaaattgtagttgtgactggtactaacggtaaaacc
ttaacaacagctttaacagttggtattttaaagaaagccttcggtcaggtggtaaccaac
ccaagtggagcaaatatgattacaggtattgtttcgaccttcctaacagctaagaaaagt
aaatctggtaaaaaaatagctgtccttgaaatagacgaagcgagtttaccccgtattaca
cagtatataaagcctagtttgttcgtctttactaatattttccgtgatcaaatggaccgt
tatggcgaaatctacacaacttatcaaatgattttagatggagctgctaacgctccgcaa
gctactatcttagctaacggtgacagtccactttttaattctaaaagcgtgactaaccct
gtgcaattctatggatttgataccgacaaacatgagccacgattagcacactataatact
gagggcattctctgtccaaagtgtcaagcaattttaacttatcgattgaacacatatgcc
aaccttggtgactacacttgtcctaattgtggttttgaacgtccaaaccttgattacgcc
ttaacaaggctaacacatctgacaaatacttcatcaggattcgttattgatggccaacaa
tataatatcaacgtgggtggcctttataatatttacaatgctttggcggcagtatctgtt
gctgaatattttggtgtagaaccaagtcaaattgaggacggatttgataaaagccgtgcc
gtttttggtcgtcaagaaacctttacaattggaaataaaaaatgtactttagttctgatt
aaaaatccagtaggagctagtcaagctcttgatatgattaaacttgctccatacccgttc
tctctctcagtactactgaatgccaattatgctgacggtattgatacttcttggatttgg
gacgctaattttgaaactattctcacgatgaatatcccagaaatatttgctggtggtgtt
cgccactctgaaattgctcgtcgcttacgtgtaactggttatgatgagaaacgcataaaa
caagctgataaactgcaagatattatgacaatgattgagcaacaagagactgagcatgct
tatattttagcaacatatacagctatgctggagtttcgtaaaattcttgctaaccacaac
gctatcagaaaggagatgaattaa

DBGET integrated database retrieval system