KEGG   Streptococcus agalactiae SA20-06: SaSA20_0789Help
Entry
SaSA20_0789       CDS       T02338                                 

Gene name
pfkA
Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
sags00010  Glycolysis / Gluconeogenesis
sags00030  Pentose phosphate pathway
sags00051  Fructose and mannose metabolism
sags00052  Galactose metabolism
sags00680  Methane metabolism
sags01100  Metabolic pathways
sags01110  Biosynthesis of secondary metabolites
sags01120  Microbial metabolism in diverse environments
sags01130  Biosynthesis of antibiotics
sags01200  Carbon metabolism
sags01230  Biosynthesis of amino acids
sags03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaSA20_0789 (pfkA)
   00030 Pentose phosphate pathway
    SaSA20_0789 (pfkA)
   00051 Fructose and mannose metabolism
    SaSA20_0789 (pfkA)
   00052 Galactose metabolism
    SaSA20_0789 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SaSA20_0789 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SaSA20_0789 (pfkA)
Enzymes [BR:sags01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SaSA20_0789 (pfkA)
Protein phosphatases and associated proteins [BR:sags01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SaSA20_0789 (pfkA)
Messenger RNA biogenesis [BR:sags03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SaSA20_0789 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFV72252
UniProt: R4ZC89
Position
836027..837049
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDT
INRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWS
GIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDD
SDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGL
AEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggtgacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtaaagcaatttctgaaggtatggaagtttacggcatcaaccaaggt
tactatggtatggtgacaggggatattttccctttggatgctaattctgttggggatact
atcaaccgtggaggaacgtttttacgttcagcacgttatcctgaatttgctgaacttgaa
ggtcagcttaaagggattgaacagcttaaaaaacacggcattgaaggtgtagtagttatc
ggtggtgatggttcttatcatggtgctatgcgtctaactgagcacggtttcccagctgtt
ggtttgccgggtacaattgataatgatatcgttggcactgactatactattggttttgat
acagcagttgcgacagcagttgagaatcttgaccgtcttcgtgatacctcagcaagtcat
aaccgtacttttgttgttgaggttatgggaagaaatgcaggagatatcgctctttggtca
ggtatcgctgcaggtgcagatcaaattattgttcctgaagaagagttcaatattgatgaa
gttgtctcaaatgttagagctggctatgcagctggtaaacatcaccaaatcatcgtcctt
gcagaaggtgttatgagtggtgatgagtttgcaaaaacaatgaaagcagcaggagatgat
agcgatcttcgtgtaacgaatttaggacatctgctccgtggtggtagtccgactgctcgt
gatcgtgtcttagcatctcgtatgggagcgtacgctgttcaattgttgaaagaaggtcgt
ggcggtttggccgttggtgtccacaacgaagaaatggttgaaagtccaattttaggttta
gcagaagaaggtgctttgttcagcttgactgatgaaggaaaaatcgttgttaataatccg
cataaagcggaccttcgcttggcagcacttaatcgtgaccttgccaaccaaagtagtaaa
taa

DBGET integrated database retrieval system