KEGG   Streptococcus agalactiae SA20-06: SaSA20_0922Help
Entry
SaSA20_0922       CDS       T02338                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sags00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966564..967841)
Genome map
AA seq 425 aa AA seqDB search
MFDFEEGYFYPAKESIDFYHHYKEDLALLAEMGFKTYRMSIAWTRIFPKGDELYPNEAGL
QFYENIFKECRKYGIEPLVTITHFDCPIYLIKHYGGWRSRKMIGFYERLVRALFTRFKGL
VKYWLTFNEINMILHAPFMGAGLYFEDGENQEQIKYQAAHHELVASAIAVKIAHEVDPNN
QIGCMLAAGQYYPNTCHPQDYWASMQKNRENYFFIDVQARGKYPNYAKKHFEHLGISIQM
TAEDLALLRDYTVDFISFSYYSSRVASGNPTVSEQVQENIFASLKNPYLKSSEWGWQIDP
LGLRITLNAIWDRYQKPMFIVENGLGAVDIPDENGYVEDDYRIDYLRQHIAAMRDAIYVD
GVNLIGYTTWGCIDLVSAGTGEMEKRYGFIYVDRNNKGEGTLKRYKKKSFYWYKKVIASN
GSQIE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttgaggaaggatacttttatccagccaaagaatcaatagatttttatcac
cattataaagaagaccttgcattacttgcagaaatgggtttcaaaacctatcgtatgtca
atagcatggacgcgtatttttccaaagggtgatgagctatatccaaatgaagctggtctt
cagttttatgaaaatatttttaaagagtgtcgtaagtatggtattgaacctttggtaacc
atcacacattttgactgtcctatctaccttattaaacattacggtgggtggcggagccgt
aaaatgattggtttttatgagcgccttgtacgagctttatttactcgttttaaggggtta
gttaaatattggttgacctttaacgaaatcaatatgattttacacgctccttttatgggc
gctggcttatattttgaagatggtgaaaatcaagagcaaattaaatatcaagcagctcac
catgagttagtggcttcggctattgcagtaaaaattgctcatgaagttgatccaaataat
caaatcggatgtatgctagctgcaggtcaatactatccaaatacgtgtcatccacaagat
tattgggcttcgatgcaaaaaaatagagaaaattatttttttattgatgtgcaagcgcgt
ggcaaataccctaattatgctaaaaaacattttgagcatttaggtatttcaattcaaatg
acagcagaagatcttgctttgttaagagactatacggttgattttatttcattttcttac
tattcaagccgagtagcttcaggtaatccaaccgtcagtgaacaggttcaagaaaatatt
ttcgcatctcttaagaatccttacttgaaatcttctgaatggggatggcaaattgatccg
cttggattacgtattaccttaaatgctatctgggatcgttatcaaaaaccgatgtttatt
gttgaaaatggacttggagcagtagatattcctgatgagaatggttacgtagaagatgat
tatcgtattgattacctccgtcagcacattgctgcaatgagagatgctatatatgtagat
ggtgttaatctaattggctatactacatggggatgtattgatttagtatctgcaggaact
ggtgaaatggaaaaacgctatggtttcatttatgttgatcgcaataataaaggagaggga
acactcaagcgttacaagaaaaaatcgttttattggtacaagaaggttattgcaagtaat
ggcagtcaaatagaataa

DBGET integrated database retrieval system