KEGG   Streptococcus agalactiae SA20-06: SaSA20_0938Help
Entry
SaSA20_0938       CDS       T02338                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sags00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(980285..980773)
Genome map
AA seq 162 aa AA seqDB search
MTTVYLSLGSNIGDRETFLKQALFSIDHLQKTKVAQISAIYETAAWGNTNQEDFFNICCQ
VETDLAPFELLDYCQEIEKRLKRVRHEHWGPRTIDIDILLFGNQVINQEDLVVPHPYMTK
RAFVLVPLLEIAPQLSLPNGSKLEDYLEKLNLGEVHYLKPVE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgtttacttgagtttaggtagtaatattggtgatagagaaacttttctgaag
caggctctcttttcaattgatcatttgcaaaagacaaaagttgcgcaaatttccgctatt
tatgaaacagctgcttgggggaatactaaccaagaagatttttttaatatatgttgtcag
gtagagacagacttagcaccttttgaattattggattattgtcaagaaattgaaaaacgc
ttaaagcgcgtgagacatgagcattggggtccaaggacaatagatattgatatcttactt
tttggtaatcaagtaattaaccaagaagatttagtagtaccccatccgtatatgacgaag
cgagcatttgttttagttccgttactcgaaatagcacctcaactaagtttacctaatggt
tctaagctagaagactatctcgaaaaattgaatttaggagaagttcattatttaaaacca
gtcgaatag

DBGET integrated database retrieval system