KEGG   Streptococcus agalactiae SA20-06: SaSA20_1018Help
Entry
SaSA20_1018       CDS       T02338                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SaSA20_1018 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SaSA20_1018 (rfbC)
Enzymes [BR:sags01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SaSA20_1018 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1060939..1061532)
Genome map
AA seq 197 aa AA seqDB search
MTEQFFDKELTCRPIEAIPGLLEFDIPVRGDNRGWFKENFQKEKMIPLGFPESFFEADKL
QNNISFNKKNTLRGLHAEPWDKYVSIADEGRVIGIWVDLREGDSFGNVYQTIIDASKGIF
VPRGVANGFQVLSDKAAYTYLVNDYWALELKPKYAFVNYADPNLGIQWENLEEAEVSEAD
KNHPLLKDVKPLKKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaattttttgataaagaattaacttgtcgcccaattgaagccattcctgga
ttgttggaattcgatattcccgttcgtggagacaaccgtggatggttcaaagagaacttt
caaaaagaaaaaatgataccgcttggtttcccagaaagcttctttgaggcagacaaacta
caaaataatatttcgtttaacaaaaaaaatactttgcgaggtctccatgcagagccttgg
gataaatatgtttcgatcgctgatgaaggacgtgtgatcggtatttgggttgacctccgt
gaaggtgacagttttggtaacgtttaccaaacgattatcgatgcctcaaaaggtatcttt
gttccacgcggtgttgctaatggtttccaagttctttcagataaagcagcttatacttat
ctcgttaacgattattgggcacttgaactcaaaccaaaatatgctttcgttaattatgca
gatccaaatctaggcattcagtgggaaaaccttgaagaagcagaagtctcagaagcagat
aagaatcacccacttctcaaagatgtaaaacctttgaagaaggaagatttgtaa

DBGET integrated database retrieval system