KEGG   Streptococcus agalactiae SA20-06: SaSA20_1180Help
Entry
SaSA20_1180       CDS       T02338                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SaSA20_1180 (malQ)
Enzymes [BR:sags01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SaSA20_1180 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1222410..1223906)
Genome map
AA seq 498 aa AA seqDB search
MKKRASGVLMHITSLPGDLGIGTFGREAYAFVDFLVETDQKFWQILPLTTTNFGDSPYQS
FSAVAGNTHLIDFDLLTLEGFISKDDYQNISFGQDPEVVDYAGLFEKRRPVLEKAVKNFL
QEERATRMLSDFLQEEKWVTDFAEFMAIKEHFGNKALQEWDDKAIIRREEEALAGYRQKL
SEVIKYHEVTQYFFYKQWFELKEYANDKGIQIIGDMPIYVSADSVEVWTMPELFKLDRDK
QPLAIAGVPADDFSDDGQLWGNPIYNWDYHKESDFDWWIYRIQSGVKMYDYLRIDHFKGF
SDYWEIRGDYQTANDGSWQPAPGPELFATIKEKLGDLPIIAENLGYIDERAERLLAGTGF
PGMKIMEFGFYDTTGNSIDIPHNYTENTIAYAGTHDNEVINGWFENLTVEQKAYAENYMR
RLPNEPITETVLRTLYATVGQTTITCMQDLLDKPADSRMNMPNTVGGNWQWRMRKEDLTE
NRKAFLKEITTIYNRGNK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgcaagtggtgtcttaatgcacatcacttctctaccaggtgatttaggt
attggaacatttggacgagaagcctacgcttttgttgattttttggtcgaaactgatcaa
aaattttggcaaattcttcccttaacaacaacaaacttcggggactctccttaccagtct
ttttctgcagtagctggtaatacacatttaattgattttgatttgctaacgcttgaaggt
ttcatttcgaaagatgactaccaaaatattagttttggacaggatccagaagttgttgat
tatgctggtctgtttgaaaaacgccgtccagttttagaaaaagcagttaaaaatttcttg
caagaagagagagcaacgagaatgctatctgatttcttgcaagaagaaaaatgggtaact
gattttgctgaatttatggcgatcaaagaacattttggtaataaggcgcttcaagaatgg
gatgacaaggctattatacgccgcgaagaagaagccttagcaggatatcgtcaaaagctt
agtgaagtgataaaatatcatgaagtaacacaatatttcttttacaaacaatggtttgag
ttaaaagaatatgctaatgataaagggattcagattatcggtgatatgccaatctacgtt
tctgccgatagtgtagaagtttggacaatgcctgaactgtttaaattagatcgcgacaaa
caaccacttgctattgctggtgtaccagcggatgatttttctgacgatggtcagctttgg
ggcaatcctatttacaattgggattaccacaaagagtcagattttgactggtggatttat
cgcattcaatctggtgttaagatgtatgactatttgcgtattgatcattttaaaggtttt
tcagattattgggaaattcgaggagattatcaaacagctaatgatggctcatggcaacca
gctcccgggccggaattatttgcaactatcaaagaaaaattaggtgatttacctattatt
gctgagaatttaggctatattgatgagagagcagagagattactggctggaacagggttc
ccaggtatgaaaatcatggaattcggtttttatgatacaacaggaaatagtattgatatt
cctcataactacacagaaaatacaattgcatatgctggaactcatgataacgaagttatt
aatggctggtttgaaaatcttacagtcgaacagaaagcttatgcagaaaattacatgcgt
cgtttgccaaatgagcccattactgagactgtactgcgtaccttgtatgcaaccgttggt
caaacaacgattacatgtatgcaagacctactagataaacctgcagatagccgtatgaac
atgccaaataccgttggaggtaactggcaatggcgtatgagaaaagaagacttaacagaa
aatcgcaaagcattcttaaaagagattacaactatttataatagagggaataaataa

DBGET integrated database retrieval system