KEGG   Streptococcus agalactiae SA20-06: SaSA20_1432Help
Entry
SaSA20_1432       CDS       T02338                                 

Definition
DNA helicase, RecD/TraA type
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sags  Streptococcus agalactiae SA20-06
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sags00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SaSA20_1432
Enzymes [BR:sags01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SaSA20_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469915..1472335
Genome map
AA seq 806 aa AA seqDB search
MEVFFTGTIERIIFENASNFFKILLLEIEDTDSDFDDVEVIITGTIADVIEGEEYTFWGT
LTQHPKYGEQLQSVRYERAKPTSGGLVKYFSSEQFKGIGKKTAQRIVELYGDNTIDKILE
SPEQLSTISGLSKINREAFIAKLKLNYGTEQVLAKLAEYGLSNRAAIQIFDHYKEESLEV
INENPYQLVEDIQGIGFKIADQLAEQVGIESDSPKRFRAAIIHTLVESSMEQGDTYIEAR
TLLEKTITLLEEARQIELDPSIVAKELTNLIAEDKVQHIGTKIFSNTLLFAEEGIKKNLQ
RILNQPLDKQLSHKDIDREIRDIQKSLNIHYDNIQEKAIREALLSKVFILTGGPGTGKTT
VINGIIEAYSELHHIDLNKNDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDSDY
QSLDDYLDCSLIIIDEFSMVDTWLANQLFDALDSHTQIIIVGDSDQLPSVGPGQALADLL
NINALPHVKLEKIFRQSEESTIVTLANQMRQGFLPEDFTAKKADRSYFEASANIIPNMIS
KIVQSALKSGIEAHEIQILAPMYRGQAGINNLNLIMQNLLNPLKDNNQFTFNDINFRIGD
KVLHLVNDTELNVFNGDIGYITDLIPAKYTESKQDEIYMTFDGQEVIYQRKEWLKITLAY
AMSIHKSQGSEFQVVILPITRQSGRMLQRNLIYTAITRSKSKLILLGEIGAFDFAVKNEG
AKRNTYLIERFENKQEIANSQKIEDSSIDQKTDSTIINTSIPKTATPIEQTNLSKITYRL
TEENYLTIDPMIGINQQDISAIFDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattttttacaggaaccattgaacgcattatatttgaaaatgccagcaatttt
tttaaaatattacttctggaaatcgaagatacggatagcgattttgatgatgtagaagta
attattactggtactatagccgacgttatagagggagaagaatatactttttggggaaca
ctaacccaacatccaaaatacggcgagcaactacaaagtgtacgctatgaaagagccaag
cctacttcaggtggccttgtgaaatacttttctagcgaacaatttaaaggaattggtaaa
aagactgcccaacgcatcgtagaactctatggagataataccattgataaaatccttgaa
tcccctgaacagttaagtacaatctcaggactatcaaaaattaatagagaagcattcatc
gctaaactgaaactcaattatggaacagagcaagttttagctaaactcgctgaatatggg
ttaagcaatcgtgctgctattcaaatatttgatcactataaagaagaatcacttgaagtg
ataaacgaaaatccttatcaacttgttgaggatatccaaggtatcggttttaaaatagct
gaccaacttgctgaacaagtcggtattgaaagtgattctcctaaacgctttcgtgctgct
attattcatactttagttgagtcttctatggagcaaggtgatacctatattgaggctcgt
actctcttggaaaaaaccattactctccttgaagaagctcgtcaaatcgaactagatcct
tcaattgttgctaaggaattgacaaatttaattgcagaagataaagtgcaacatattgga
actaaaatttttagtaatactctactttttgccgaagaaggcatcaaaaaaaacttacaa
cgaatactaaatcagccccttgataaacaactaagtcacaaagatattgaccgtgaaatc
agagatattcaaaaatctttaaatatccactacgataatatccaagaaaaagctattaga
gaagctttactaagtaaggtatttatcttaactggtggcccaggaacaggtaaaacaaca
gttataaatggtattattgaagcctattccgagttacatcatattgatttaaacaaaaat
gatattcctattgtacttgctgctcctacaggtcgtgctgctagacgcatgaatgaactt
accggtttaccgagtgctactattcatagacatttgggattaaacggagatagtgactat
caaagtctagatgactatctagattgttccttaattatcattgatgaattttcaatggtt
gacacttggcttgctaatcaattatttgacgctttggactcgcacacacaaattattatt
gtcggagatagtgatcaattaccgtctgtaggtccaggacaagctctagcagatctttta
aatataaatgcacttccacacgttaagcttgaaaagatttttagacaatcagaagaatca
actattgtgactttagctaatcaaatgaggcagggctttttgccagaggacttcacagct
aaaaaagccgatcgctcatactttgaagcatctgctaatatcatcccaaatatgatttct
aaaattgttcaatctgcacttaagagcggtattgaagctcatgaaattcaaattttagct
cctatgtatcgcggccaagcaggtattaataatcttaaccttatcatgcaaaatctcctc
aatccattaaaagataataaccaatttacttttaatgatataaatttccgaataggagat
aaagtgttacatttagtcaacgatacagagcttaatgtttttaatggggatattggttac
ataacggatcttataccagctaaatatactgagagcaagcaagatgagatttatatgact
tttgatggtcaagaagttatctaccaacgcaaagaatggcttaaaataacactagcctat
gctatgagtattcataaatcacagggttctgaatttcaagttgttattctgccaataacg
agacagagtggtcgaatgttacagcgaaaccttatttatacagctattacgagatctaaa
agtaaactaatacttttaggagaaattggtgcatttgatttcgctgttaaaaacgagggg
gcaaagcgcaatacttatctgatagaaagatttgaaaacaagcaagaaatagctaattct
caaaaaattgaagatagttcaatagatcaaaagactgacagcacaataattaatacgtcc
attccaaaaacagcaacgccaattgagcagactaatctttcaaaaataacttatcgccta
actgaagaaaattatttaacaatcgatccaatgattggtattaatcaacaagatataagt
gcaatttttgatagtaaataa

DBGET integrated database retrieval system