KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0259Help
Entry
SaurJH1_0259      CDS       T00556                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SaurJH1_0259
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SaurJH1_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(306695..307609)
Genome map
AA seq 304 aa AA seqDB search
MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGTDGVADFILEDFKAAHIDTSYIIKTTEAKTGQAFITVNAEGQNTIYVYGGANMTMT
PEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLI
DIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLITLGKQGTYFATKNQSQHIE
AYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEE
VNQV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaagttgttattttaggttcaacgaatgtcgatcaatttttaacagttgaa
agatatgcacaaccaggcgaaacattacatgttgaagaagcacaaaaagcattcggcgga
ggtaaaggtgccaaccaggctattgccactgcacgcatgcaagcagacacaacatttatt
actaaaattggcactgatggcgttgctgatttcatcttagaagattttaaagcggctcat
attgatacatcatatattatcaaaacaactgaagcaaaaacgggccaagcctttatcact
gtgaatgcagaaggacaaaacaccatctatgtttatggtggtgcgaatatgacgatgaca
cctgaagatgttattaacgcaaaagacgctataatcaatgcagactttgtcgttgcacaa
ttagaagtacccatcccggctattatatctgcatttgaaattgccaaggcacatggtgtg
acgacagtattaaatcctgcaccagcgaaagcattacctaatgaattattatcattaatc
gatattattgtgccaaacgaaacagaagccgaattgttatctgggattaaagtaactaat
gaacaatctatgaaagacaatgccaattactttttatctttaggcattaagactgttttg
attacgctaggtaagcaaggtacatattttgctactaaaaatcaaagccaacacatcgaa
gcttataaagtaaatgcgattgatacaactgctgcaggcgacacatttattggtgcattt
gtcagtcgcttaaacaagtcgcaagataacttagcagatgctattgattttggtaataaa
gcgagctcactcactgtacaaaaacacggcgcgcaagcatctattcctctactagaagaa
gtaaatcaagtttaa

DBGET integrated database retrieval system