KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0529Help
Entry
SaurJH1_0529      CDS       T00556                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaurJH1_0529 (ipk)
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SaurJH1_0529 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
559467..560315
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaaaattaattttacgctcgatacactttttaaaaga
aatgatggctatcatgagattgaaatgataatgacaacagttgatttaaatgatcgttta
acttttcataaaagaaaagatcgaaagatagttgttgagattgaacataattatgtgcct
tctaatcataaaaatctcgcatatcgtgcagcgcaactatttattgagcaatatcaacta
aagcaaggtgtaacaatttctatcgataaagaaatacctgtttctgctggcttagctgga
ggttcggctgatgcagcagcaacgttaagaggattgaatcgactttttgatataggggcg
agtttggaagaattggctctactaggcagtaaaattgggacagatattccgttttgtatt
tataataaaactgcactatgtactggaagaggagagaaaatcgagtttttaaataaacca
ccttcagcttgggtgattcttgctaaaccaaacttaggcatatcatcaccagatatattt
aagttgatcaatttagataagcgttacgacgtacatacgaaaatgtgttatgaggcctta
gaaaatcgagattatcaacaattatgtcaaagtttgtctaatcgattagagccaatttct
gtttcaaaacacccacaaatcgataaattaaaaaataatatgttgaaaagtggtgcagat
ggtgcgttaatgagtggaagcggaccgactgtgtatgggctagcacgaaaagaaagccaa
gcaaaaaatatttataatgcagttaacggttgttgtaatgaagtgtacttagttagacta
ttaggatag

DBGET integrated database retrieval system