KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0551Help
Entry
SaurJH1_0551      CDS       T00556                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SaurJH1_0551
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SaurJH1_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
581778..582254
Genome map
AA seq 158 aa AA seqDB search
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNE
RAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatacttaggattaggtagtaatattggtgatagagaaagccagttaaac
gatgctataaagattttgaatgaatatgatggtattagcgtatctaatatttctccgatt
tatgaaacagcaccagttgggtatactgagcaacctaactttttaaatttgtgtgttgaa
attcaaacaacactcacagtattacaactgttggaatgttgtttgaagacagaagaatgt
ttacaccgtattagaaaggaacgatggggtcctagaactttagatgtggatattttgttg
tatggagaagaaatgatagatttaccaaaactgtcggtgccacatccgagaatgaatgaa
cgtgcatttgttttaatcccattaaatgatatagcagcaaatgtcgtagaaccacgttcg
aaattgaaagtgaaagatttagtttttgtcgatgacagtgtaaagagatataaataa

DBGET integrated database retrieval system