KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0593Help
Entry
SaurJH1_0593      CDS       T00556                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SaurJH1_0593
   00240 Pyrimidine metabolism
    SaurJH1_0593
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SaurJH1_0593
    2.7.1.76  2'-deoxyadenosine kinase
     SaurJH1_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(641772..642434)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
ggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttatagcgattttgaacgatggagtttc
catttgcaaatttacttcttagctgaacgttttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaagatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaaccagatgtaatgatttatttagaatgtaac
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaattaatacagac
cctgaatactggaaaaagctatttaaacgctatgacgattggattaatagctttaatgca
tgtccagttgtacgtatcaatattaatgaatatgatatccataaggaccccgaatcttta
aatcctatgatagacaaaattgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system