KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0643Help
Entry
SaurJH1_0643      CDS       T00556                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SaurJH1_0643 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_0643 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SaurJH1_0643 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SaurJH1_0643 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SaurJH1_0643 (adhA)
   00626 Naphthalene degradation
    SaurJH1_0643 (adhA)
Enzymes [BR:sah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SaurJH1_0643 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
695884..696894
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcattggtacaaacggaatattgtggtgtttgtcataccgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcagaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtagatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagcagcg
tcttctattacatgcgcaggtgtgacaacttataaagctgtaaaagtaagtaatgtaaaa
cctggtcaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgccttcgacattaatgatgataaattagca
ttcgcgaaagaattaggtgcagatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacgccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgacggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtactataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system