KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1177Help
Entry
SaurJH1_1177      CDS       T00556                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00010  Glycolysis / Gluconeogenesis
sah00020  Citrate cycle (TCA cycle)
sah00620  Pyruvate metabolism
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
Module
sah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_1177
   00020 Citrate cycle (TCA cycle)
    SaurJH1_1177
   00620 Pyruvate metabolism
    SaurJH1_1177
Enzymes [BR:sah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SaurJH1_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 ATP-synt_ab_Xtn HlyD_D23 DUF896 DUF2090 HTH_17 NRIP1_repr_3
Motif
Other DBs
NCBI-ProteinID: ABR52031
JGI: SaurJH11177
Position
1197478..1198770
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
EVAETPAAPAAVSLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagctgaggtacaa
aacgataaatcagtagtagaaatcccatcaccagtatctggtactgtagaagaagttatg
gtagaagaaggtacagtagctgtagttggtgacgttattgttaaaatcgatgcacctgat
gcagaagatatgcaatttaaaggtcatgatgatgattcatcatctaaagaagaacctgcg
aaagaggaagcgccagcagagcaagcacctgtagctactcaaactgaagaagtagatgaa
aacagaactgttaaagcaatgccttcagtacgtaaatacgcacgtgaaaaaggtgttaac
attaaagcagtttctggatctggtaaaaatggtcgtattacaaaagaagatgtagatgca
tacttaaatggtggtgcaccaacagcttcaaatgaatcagctgcttcagctacaagtgaa
gaagttgctgaaactcctgcagcacctgcagcagtatcattagaaggcgacttcccagaa
acaactgaaaaaatccctgctatgcgtagagcaattgcgaaagcaatggttaactctaag
catactgcacctcatgtaacattaatggatgaaattgatgttcaagcattatgggatcac
cgtaagaaatttaaagaaatcgcagctgaacaaggtactaagttaacattcttaccttat
gttgttaaagcacttgtttctgcattgaaaaaatacccagcacttaacacttcattcaat
gaagaagctggtgaaattgtgcataaacattattggaatatcggtattgcggcggacact
gatagaggtttattagtacctgtagtgaaacatgctgatcgtaagtctattttccaaatt
tcagatgaaattaatgaattagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgcaacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaattggccgtattgctcaaaaacct
atcgttaaagatggagaaattgttgcagcaccagtattagcattatcattaagctttgac
cacagacaaattgatggtgcaactggccaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system