KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2234Help
Entry
SaurJH1_2234      CDS       T00556                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sah01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sah00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2328792..2329700)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIE
KFHSEQKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattataggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaacagcaattagatatgctggattaatttcaagattaaag
caattagaccttgatgtatatgacaagggggatattaaggtacctgctgtgaacattgaa
aaatttcatagtgaacaaaaaggattaagaaattatgatgaaattatagatgttaatcaa
aaattaaataaagaggtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggtgatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggcgaaggtcccaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattagggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgctttagatccgcttgaaacgccaggc
actggtactagagttttgggtggtcttagttatagagaaagccattttgcattggaatta
ctgcatcaatcacatttaatttcctcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system