KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2407Help
Entry
SaurJH1_2407      CDS       T00556                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_2407
   00052 Galactose metabolism
    SaurJH1_2407
Enzymes [BR:sah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SaurJH1_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2495433..2496452)
Genome map
AA seq 339 aa AA seqDB search
MIVEVEHQRQGVDLIKIDNDETKIIFTNYGARVVSWKYHDNNIVLGNVVEADEFYHSNPF
KFGASIGRYSGRIDNAKFKLKGKEYQLEKNNGEHHLHGGCHGLDNKLFDYEIRNEIAQIK
VIFKTVLKSADDHFPGDIDVTITHIYDADHQWSIEYEAVASEDTLFSPMNHVYFNLNRDN
NVVDNHRISSNQLDMYVLDERNIVTGDILDLHEVFEDNKIKLSDIFTSQHAQLSQQMTRF
GGLDHPFTVGEHKMYVENHEFMLEVDTDMPHVVFFTFNQPDEWDSPFNIYKPHSGFTLET
QFLPNDINLYGEKAPSILKAGEVFNSKTSFRIEEKVEND
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagttgagcaccaaagacaaggtgtagatttaatcaaaattgataatgat
gaaactaaaattatttttacgaattatggagcaagagtagtgtcttggaaatatcatgat
aataatattgttcttggaaatgttgttgaagcggatgagttttatcatagtaatcctttt
aaatttggtgcttctataggaagatatagcggtagaattgataatgctaaatttaagttg
aaaggtaaagaatatcagttagaaaaaaacaacggtgaacatcatttacatggtggatgt
catggtttggacaataagttatttgattatgaaattagaaatgaaattgctcaaattaaa
gttatatttaagacggtgttgaaatcagctgatgatcatttcccgggtgatatcgatgtg
acgattacacatatttatgatgcggatcaccaatggtcgattgaatacgaagcagttgca
tcagaagacacattgtttagtcctatgaatcatgtgtacttcaatttgaatcgagataat
aatgtcgttgataatcatcgcatttcaagtaatcaattagatatgtatgtattagatgag
cgaaatattgttacaggtgatattctagatttacatgaagtgtttgaagataacaagata
aaattgagtgatatttttacatcacaacatgcgcaattaagccaacaaatgacacgtttt
ggtggtctcgatcacccatttacagttggtgaacataaaatgtatgttgaaaatcatgaa
tttatgttagaggtcgatacagatatgcctcatgttgtgttctttacttttaaccagcct
gatgagtgggatagtccatttaatatttataaaccacattctggctttacattagaaaca
caatttttaccaaatgatattaatttatatggtgaaaaagcaccgtcaattttaaaagct
ggtgaagtgttcaattcgaaaacaagtttccgtatcgaagaaaaagtagaaaatgattaa

DBGET integrated database retrieval system