KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2531Help
Entry
SaurJH1_2531      CDS       T00556                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(2622391..2623467)
Genome map
AA seq 358 aa AA seqDB search
MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
NRYGCALAVEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcagtcaaattacttaaacatttaacagatgtaaacggcattgctggttat
gaaatgcaagttaaagaagcaatgcgtaactatatagagcctgtcagtgatcaaattatt
gaagataacttgggtggcatttttggaaagaaaaatgctgagaatggtcaatactcaatt
atgatttctggtcatatggatgaagttggttttatggtaacaaagattgataaacatggt
tttatttcatttacgccagttggtggatggtggaatcaagtcatgctatctcaaaaagta
acgattacaacagattcgggcaaagaaattagaggtatcatcggttctaaaccgccacat
gtcttaacgcctgaagaacgtaaaaagccaatggaaatcaaaaatatgtttatagatatt
ggtgttagtagcaaggaagaagctgaagaagctggcgttgaagtaggcaatatggtaacg
ccatatagtgaatttgaagtgcttgcaaatgataaatatttaactgcgaaagcatttgat
aatcgctatggctgtgcattagctgttgaggtattaaaacgtttaaaagatgaaaatatt
ggaattaacttatacagtggtgccacagtgcaagaagaagttggtttgcgtggtgcgaaa
gtggcagcgaatacaattaaaccagatttggcgatagctgtcgatgtaggtattgcttat
gataccccaggtatgtcaggtcaaacgagcgatagtaaactaggcggtggtccagttgtc
attatgatggatgctacaagtattgctcaccaaggtttgcgtaagcatattaaagatgta
gctaaggaacataacatcgaagtacaatgggatacgacaccaggtggaggtacagatgcg
ggaagtattcatgtcgcaaatgaaggtattccaacgatgacaatcggtgttacgctgcga
tacatgcattctaatgtttcagtgctcaatgtagatgattatgaaaattctatccgtctt
gttactgaaattgtccgttcattgaatgatgaaagttataaaaatatcatgtggtaa

DBGET integrated database retrieval system