KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0269Help
Entry
Saci_0269         CDS       T00251                                 

Definition
putative inactivated transposase
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(226899..227720)
Genome map
AA seq 273 aa AA seqDB search
MEELIEAKILNYGKLKEIHKQILFIREYSKIVKGGPPPSNIPRELYYQATSSSNKIRYGP
LRIIGNTSPYRIPEVDALVSSTRRSPPLYAIAEFSDDVRVFLAYEKPKSIVGIDIGVRHL
ITVVSIREDSLWKVRYWGNDVITEEMIKVIGDPQGVSEIRTIKGKIGNIIRDVVSFIQDL
NPKVVAIEDLEYFESKIGSALRTVEKELESHLYRKGVKFRKLPPYYTSKICSNCGFRRGE
VMGPLFVCPSCGYKADRDFNAAYNLALQCKYTC
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctgatagaagctaaaattttgaattacggaaaattaaaagagatccataaa
cagattttgtttatcagggagtactcgaagatagtgaaggggggtcctcccccctcaaat
ataccccgtgaattgtattatcaagccacctcctcaagtaacaaaataagatacggtcca
ttgagaataataggaaatacaagtccctatagaatacctgaagtcgatgctctagtgagt
tcgacaagaagatcacctcctctctatgctatagctgaattttcagatgacgtgagagtt
tttctagcttatgaaaagcctaaatcaatagttggtattgacatcggggtgaggcactta
atcacagtggtgtcgattagagaagatagcctctggaaagtaagatattggggaaacgat
gtaataactgaagagatgataaaggtaatcggtgatccgcagggagtttcagaaataagg
acgataaagggtaagattggtaatatcataagagatgttgtgtcatttatccaagacctt
aaccctaaagtagtcgcaatagaggatttagaatattttgagagtaaaataggcagtgca
ttgagaactgtggagaaagaactagagagtcacctatataggaagggagttaagttcaga
aaacttcccccatattacacgagcaaaatttgctctaactgtggattcaggagaggtgaa
gtgatgggaccgttatttgtctgtccatcatgtggttacaaggctgacagagactttaac
gccgcgtataacctggcactacaatgtaaatatacttgttag

DBGET integrated database retrieval system