KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0281Help
Entry
Saci_0281         CDS       T00251                                 

Definition
DEAD/DEAH box helicase
Orthology
K06877  
DEAD/DEAH box helicase domain-containing protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237191..239431
Genome map
AA seq 746 aa AA seqDB search
MSTELIDRVSERLSYFNVKIAHIFTETALEPDLGAKVEDLPLGGNLKQMLKQVGIHRLYK
FQEEAYNKISHGNNVMIVSGTGTGKTEAFLIPLLDLALKGERSVLVYPTKALARDQLERV
RRLASPLGVEMGVFDGDTPEKERKRLYENPPHILITNPDMIHIGLPLSYRFRRLIRTADH
FVFDEVHSYDGVLGSHIRMISDRLRELTDYHVIGSSATIDASPYLFEELFGVKGEIIYGS
PRRKGVAIHALLNIGSASRWTLSAYLTAFLVKEGYKVLTFVDSQQMAELIAKITARFGEE
NIHVHRAGINKEDRLKVEESIKSGKIKGVIATPTLELGIDIGDLDVVIMAENPPNYTKYL
QRAGRAGRRSKIGYIFTLLGEDPIDTYYLRKPTEFFNRKVLPLTFDVSNKEVVKIHAAAY
LAEKGSLRLGRVIPKAWVKAYEELVKDGKVKIENNVVSALPPLYSYVRSTYLRSTGPIVG
LYDRDGNRLGERELPVALYDIYPQAIYFISKRNYIVEDVKLDSLRATLRRAKDDLSYYTK
PVYSTHLLSFEEIEERKVFGLPVKYGISEIMISVDGFATYEISGNKNKPKQEFFYKEPII
FTYTTKGVLIKHPILEEFNEFDSIEAYHATEHVLISSARVVAGASMTDLAGISYPTGHVV
IYDSVVGGSGVSKLLYDRLEEAYDISIDITGKCDCEDGCPKCIYSPYCGNNNKMLSRRKS
HRLMTKIKLGEFDNSVEQNINGKPIV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgtccactgaattaattgatagagtttcagagaggttatcgtattttaacgtcaagatt
gcccacatatttacggagactgctcttgaacctgatctgggggctaaggtagaggactta
ccattaggtggaaatttgaaacaaatgttgaagcaagtggggatacacagactctacaaa
tttcaggaggaggcttataataaaatatctcatggaaataacgtaatgatagtttcagga
acggggacagggaaaactgaagcgttcttaatccctttgttggatcttgcattgaaagga
gagaggagtgttttagtttatcccactaaggcattagctcgtgatcagttggagagggtg
aggaggttagcctcacctttaggagtagagatgggagtttttgatggtgatacacctgag
aaggagaggaagcgattatacgagaatcctccacatattcttatcacgaatcctgatatg
attcatataggtctacctctcagctataggtttagaaggctgattagaacagcagatcat
tttgtatttgatgaggttcactcatatgatggcgttctaggctcacatataaggatgatt
agtgataggttaagggagttaactgactaccatgtcataggctcaagtgcgacaatagat
gcttctccatatttgttcgaagagttatttggagtaaaaggggagattatttatggctcc
cctagaagaaaaggcgttgcaattcacgctctactaaacattgggtcagctagtagatgg
actctctctgcataccttaccgcatttcttgtgaaggagggttataaggttcttacgttt
gtggactcacaacaaatggctgaattaattgcaaagataactgctagatttggtgaagag
aacattcatgttcaccgagctgggataaataaagaagataggctaaaagttgaagaatct
attaaatcagggaaaattaaaggagtcatagctactcctacccttgaacttggaatagac
ataggcgatttagatgtggtaataatggctgaaaatcctccaaactacacaaagtatctg
cagagggctggcagagcagggaggagaagtaagatcggttatatcttcaccttattgggt
gaagatcctattgatacatattaccttaggaagcctaccgaatttttcaataggaaagtc
ttacccttaacatttgatgtgagtaataaggaggtagtaaagattcatgctgcagcctat
ttagctgaaaaggggagtttgaggttgggaagagtaattcccaaagcatgggtaaaagct
tatgaggagttagtaaaagacggaaaggtgaaaattgaaaacaacgttgtttccgcttta
cctcctctatattcctacgtgagatcgacttacttaaggtccacaggacctatagtaggt
ctatatgatagggatggaaacagattgggagagagggaattacctgtcgcgctttatgat
atttatcctcaggcaatttactttatatcaaaaaggaattacattgttgaagatgtaaaa
ctggattccctaagggctactctaagaagagctaaagatgacttgagctattacactaaa
cccgtttactctacacaccttctgtcctttgaggaaattgaggaaagaaaagtatttggt
ttacctgtgaagtatggaatctctgaaataatgattagcgtagacggttttgctacatat
gaaatatcagggaataaaaataaacctaagcaggagtttttctataaagaacctataata
tttacatataccacaaaaggagtcttgatcaagcacccgatattggaagagttcaatgag
ttcgattcaattgaagcttatcacgctacagaacacgttttgatttcttcagcgagggtt
gttgcaggggcatcaatgacggatctggctgggataagttatcccactggacacgtggtg
atatatgattctgttgtcggaggaagtggagtaagtaagttgttatatgataggttagag
gaggcttatgatatatctatagatattacaggaaagtgtgattgcgaagatggttgccct
aaatgtatttatagcccttactgtggtaataacaacaaaatgttatctagaagaaaatcg
catagattgatgactaaaatcaaacttggtgaatttgataattcggttgaacaaaatatt
aatggtaaacccatagtttag

DBGET integrated database retrieval system