KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0410Help
Entry
Saci_0410         CDS       T00251                                 

Definition
zinc-binding dehydrogenase (EC:1.1.1.-)
Orthology
K00008  
L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Saci_0410
   00051 Fructose and mannose metabolism
    Saci_0410
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Saci_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350533..351552
Genome map
AA seq 339 aa AA seqDB search
MKAVIIENGRASIKDMDKPSIKEKGDIIIKMKACGLCGTDIEKLRGQYTASQPIIGHEPS
GIIEESSVDSLKPGQRVFAHHHVPCYECYYCTHGSATMCPHYRRTNIEPGGFAEYFRVPA
WNVKRGGVLVLPDHVSFEEGAFIEPLATVVRAQRRVKLNRGDNVLVVGAGPMGLLHVMLS
KVNGASKTIVTDIADFRVEYAYKVGADYSFNSKKIDTINEVKKLTDGRGVDIAIIASGAP
SAILSGLLSVRKGGQVLLFGVPFKGTVLNYDISDLLNNEISIISSNAAIEEDTVDALKII
SERKIDVSKLVTHKFTIDQFNEAVRVAEEGQAIKVIIQD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgtaattattgaaaatggcagagcgtcaataaaggatatggataaaccttca
atcaaggaaaaaggagatattataataaagatgaaagcctgtgggctatgtggtactgat
atcgaaaaacttcgcggacaatacacagcgtctcagccaattataggtcatgaaccatca
gggatcattgaggagtcaagtgtagatagtctaaaacccggtcagagagtattcgcacat
catcacgttccttgttatgagtgttattattgcactcatggaagtgcaaccatgtgtcct
cactatagaaggactaatattgagcccggaggttttgcagaatactttagagtcccagcc
tggaatgtgaaaaggggaggtgtactagttcttcctgatcatgttagttttgaggaagga
gccttcattgaacctttggcaactgttgtaagagcacaaaggagggtcaagttaaacaga
ggagataatgtgttggtagtaggagcaggacctatgggattgctccacgtaatgctaagt
aaggtaaatggagcctctaaaaccatagtaactgacatagcagattttagggttgagtat
gcttataaagtaggggctgattactcatttaattctaaaaagatagacactataaatgag
gttaagaaactaacagacggtagaggagtggatatagctattatagcttcaggcgcacct
tcagcaatcttatcaggtcttctctctgtaagaaaaggaggtcaagttctcctgtttgga
gttccatttaagggtactgtcctgaactatgatataagtgatctcttaaacaacgaaatc
tcaataatctcaagtaatgccgctattgaagaagatactgtagatgcgttgaaaataata
tctgagagaaaaatagacgtttccaaactagtaacccataaatttactattgaccagttc
aatgaagccgtaagggtagctgaagagggacaagccataaaggtaataatacaagattga

DBGET integrated database retrieval system