KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0487Help
Entry
Saci_0487         CDS       T00251                                 

Definition
transposase
Orthology
K07496  
putative transposase
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405920..407224
Genome map
AA seq 434 aa AA seqDB search
MKRSNIVRLVVSKDVGKKLRELATWTAKCWNEVNWLRMQQFKEGKMVDFNDTEKVVYAKY
KEYLKVNAQQVCRKNAEAWRSFFSLMKDKKDGKLPSWFKPRPPGYWKDKRGSYKLLILIR
NDRYTVDENARTIYLKDFGLTLHFKGKLKWKGKQGRLEIFHNGLHWCASIPVEVEVNAKP
KGNGIAGVDLGIVNLATVVFDDSSWVLFKGGSVLSEYENYSRKIAITQKKLSLHKQERSK
RLKALFLKRKRFLKHVLNSMARKTVETAYEKGVSIIKVGYPKEISKHHGNKLTVNFWNYN
YVIRRMQEVSEEYGIKVETVNEAYTSIVCSLCGEAHENGRIHRGLFKCPHIGKVVNADLN
GAINILHIPKSRGGWSEGNSTKGIGVKWLKTQPVVYHWTSGAGWVFKSPTSCEAMGMKVV
NHRPVNRPRGTLTL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggagtaatatagttagactagttgtctcgaaggacgtgggcaagaagttgagg
gagctagcaacatggactgccaagtgttggaacgaggttaactggttgaggatgcaacag
ttcaaggaagggaagatggtggactttaacgacactgagaaagtagtgtacgctaaatac
aaggagtacttaaaggtaaatgcccaacaagtgtgtaggaagaacgccgaggcatggcgt
tccttcttctcgctaatgaaggacaagaaagacggtaagttgcctagctggtttaagcct
agaccaccagggtattggaaggataaacgtggtagctacaaactgttaatactaatcaga
aatgataggtatacagtagacgagaacgctagaacaatttatctgaaggactttgggtta
acacttcacttcaaaggcaagcttaagtggaagggcaaacaaggaaggttagagatattc
cataatggactacattggtgtgcatctataccagttgaggtggaggttaacgctaagccc
aaaggtaatggtatagctggagtagatttaggtattgttaacttggctactgtagtgttc
gatgatagctcgtgggtgttgttcaaaggtggttctgtactatcagagtatgagaactac
tctagaaagattgcaattacgcagaaaaagttgtcattgcataagcaagagaggagtaag
aggttgaaggcgttgtttctaaagaggaagaggttcttaaaacacgtgttgaactctatg
gctaggaagactgtagagactgcttacgagaaaggagtatcgataattaaggtcgggtat
cccaaggaaatatcaaaacaccacgggaataagctcactgtaaacttctggaactacaac
tacgttattaggaggatgcaagaggtctcagaggagtacggcatcaaagtcgaaacggtg
aacgaggcttatacttcaattgtgtgttccctatgtggggaagcccatgaaaatgggcgt
atacaccgtggtttgtttaagtgtccccacatagggaaagtcgttaacgcagacttgaac
ggggcgataaacatcctacatatccccaagtcccgaggagggtggagtgagggtaactcc
accaaagggataggggtaaaatggctgaagacccagccagtggtctaccactggacgagc
ggagcggggtgggtgtttaaatcacccactagctgtgaagcgatgggaatgaaggtggtg
aaccacagacctgtgaaccgccctaggggaaccctcaccctttag

DBGET integrated database retrieval system