KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0504Help
Entry
Saci_0504         CDS       T00251                                 

Definition
C-terminal of inactivated transposase (ISC1476-like)
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417900..418895
Genome map
AA seq 331 aa AA seqDB search
MNGTWKKYYEKYKKVLGVNAQAVLQKKNNEAWSSFFSLLKNKDKLPLFMNHVSPPGYWKE
DGKRKLILVVRQDRYKVDEERHALILKDWKMEIPFSGRLRWSGVQGRLEIHIINNRFYAY
IPVDVGRVVAKRSGKLVKDSLIIHGERGKIQISSPKGNKVASVDLGINMLATVIVDDGTV
LFYRGSVVKSDYFYFQKKIAELDRLKSEAEKIQEVEAREEVLEERKRLFNKLYRRLLHYY
RTLASHLAKALWNLGVSTVYLGYPYFISQDKGNKFTVNIWSYRKLIEAIMNKLHEYGIKT
FLVVEYNTSRYCAYHDVEVVRKPRGLTSSPP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggaacgtggaagaagtactatgagaagtacaagaaggtactaggagtaaacgct
caggccgttcttcaaaaaaaaaacaacgaggcttggtcttcgttcttttcgctactgaag
aacaaggataagctaccgttgttcatgaaccatgtttcaccacccggttattggaaagaa
gacggaaagaggaagctgatccttgtggttaggcaagaccgctataaggtcgatgaagaa
agacacgccttaatcttaaaggactggaagatggaaataccattctcagggcgtcttagg
tggtctggtgtacaaggtaggctagaaattcatattattaataacaggttttatgcatac
ataccagttgacgttggcagagtcgtagctaagaggagtggtaaactagtaaaggactcc
ctcattattcacggtgagaggggtaaaatacagatatcctcacctaaaggtaacaaggta
gcgtctgtcgatctcggtattaacatgctggctaccgtcatagttgacgatggtaccgtt
ctcttttaccgtggctctgttgttaagagtgactacttctacttccagaagaagattgct
gagctggacagactgaagagtgaggctgagaagatccaagaagtagaggctagggaagag
gtattagaagagaggaaaaggctcttcaataaactataccgtagacttcttcattactac
agaactttagcgtcacacctagctaaggcgttatggaacctcggtgtctcgacggtgtac
ttaggctacccatactttatttctcaggacaagggcaataagtttactgtgaacatatgg
tcttaccgcaaactcatcgaggctataatgaacaagcttcatgagtacggtataaagacg
ttcctagttgtggaatataatacttctagatattgtgcttaccacgacgttgaagtagta
agaaagcctaggggtctgacctcctccccgccctaa

DBGET integrated database retrieval system