KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0557Help
Entry
Saci_0557         CDS       T00251                                 

Gene name
adh
Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454323..455327)
Genome map
AA seq 334 aa AA seqDB search
MRAAVLEEYKKPLRISEVDSPSINESSEVLLQVTATGLCHGDIHIAMGEWDSQIQVNLPI
ILGHEVVGRVLQSNHDKIKKNDLVLVYNAFGCKNCKYCKFKEYQFCEKVKVIGVNLNGGF
AEYVKIPDGDNLVRVNTSDPIKLAPLADAGLTAYNSVKDLEENSKVLIIGTGAVALIALQ
LLKLKNVDVTVIGENQLKLDSAEKLGADEVISIKREEDSYLSLLPGKKFDYILDYVGSTR
TLAESPWLLNKKGELRIIGEFGGVLRAEEQLLVLRGLRIRGILYGSLQDLKHILDIYLKG
KIDTLTTVYKLEDINEAITDVTEGKVVGRAVIVP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcagttcttgaagaatataaaaaaccactgagaatatcagaggttgactct
ccttcaataaatgagagctctgaagttttattacaagtgacggcaactggattatgccat
ggagatatacatatagctatgggagaatgggattctcagattcaggtaaatcttcccata
atacttggtcatgaagttgttggaagagtacttcaaagcaaccatgataaaattaagaaa
aatgatctagttttagtatataacgcctttggttgtaaaaattgtaaatactgtaaattt
aaagagtatcaattttgtgaaaaagtgaaagttataggagtaaaccttaacggaggattt
gctgaatatgtcaaaattcctgatggcgacaatctggttagggttaatacctcagatcca
ataaagttagcacctcttgccgatgctgggttgactgcttataatagtgttaaggattta
gaagagaattctaaagtcctgataataggaactggtgccgtagcactgatagctttacag
cttttgaagctaaaaaatgtggatgttacagtaattggtgagaatcaactaaaacttgat
agtgcagaaaaattaggtgcagatgaagttatatcaattaagcgagaagaagatagttat
ctttctctgctcccagggaagaaattcgattatattttagattatgtaggctcaacgaga
accttagccgaatcaccctggctcttgaataaaaaaggcgaattaagaataattggggaa
tttggtggagtccttagagcggaagaacaattactagttcttagaggtttaagaatacga
gggatactttatggtagccttcaagatctaaaacatattttagatatttatttaaagggt
aagattgatacacttaccacggtgtataagctagaggatataaatgaggctattactgat
gtaactgaaggtaaggtagtaggaagggcagttattgtaccctaa

DBGET integrated database retrieval system