KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0814Help
Entry
Saci_0814         CDS       T00251                                 

Definition
DEAD/DEAH box helicase
Orthology
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Brite
Enzymes [BR:sai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Saci_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650808..653543)
Genome map
AA seq 911 aa AA seqDB search
MISVSQTFINKLNELGYKSLTPIQKIGIPIILKGKNTIVIAPTGFGKTETAIFPVFYKIL
SSNAEKISAIYITPLRALNRDLEDRLSRIGSALGIKIAIRHGDSTERQRKRILEDPPDLL
LTTPETLLYLLVNQKMRELLGNIRWIIIDELQEMLDEKRGYELLLAIQRLKRLSKYEIQL
IGLSATIGDIELAKRFIGRNVEVAEYNTRKDVKIELVIPTVSKDLAELSYKTGLHPDTLA
RIRELEKLIKENKPVLVFTNVRESTEFLASELSKLSQLKVRTHHGSLSREIRLEAEKEFK
TGNLDALIATSSLELGIDVGTINAVIQYTSPKQVIRLVQRIGRSGHSINKVSSGFLLPSH
DIFDILECKSIIDNLKEGYLEKPIVEPKPYDVMAHEIAGLVLEGITDKKEIFNLIKSSFQ
YNDLTEEEFEETLSILESARIIRKNKDKISPAGRLWRYYYSTNMIPDSIKDYIVIDHISN
TKIGTLDYEFVATLDENTVFILGGKIWRVVSIEENRIYVENAQLKSGVLPSWFGESIPVE
REISIKVYDYIERIERGDQIDLPKEILEKISSLLEEQKRRGYPVPTKSKILVEINNDLIV
LHAGLGSRGNNTLGALLSLLLTQVKGVRTTYRSDPYHIAIASLVPVSKEEFTKAIKILNS
LSSSEFEDLLKRAIKESPQYKWKLLIEAERFGLIDKQKTDITFSQTLLKAYTDTLVGEEA
VKELMYKNYDVTLREFLTRLTWECIEVPGFSPLAKEFLNKLFVAAHSDEKGVMIEIFRRK
LLNNKVKIICMVCGWNNIYYAAEVPDRCTKCGSIFLTVTDEDDKESVEIIKKVIKGSKIS
KNEKKKFEILQNISSMFSTYKKYVAIGLSARGVGINNIGKVLNKLSDGEDRFFESLLEEE
RKFLRTRKYWQ
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgataagtgtttctcagacatttatcaataagttgaacgaacttggctataagagtctt
acccctatacaaaaaataggaataccaattatactcaagggtaagaacactattgttatt
gcaccgactggctttggaaaaacagaaactgctattttcccagttttttataaaatacta
agctcaaatgctgagaaaatttctgctatatatattactccattaagagcattaaataga
gatcttgaagatagattaagtaggataggtagcgcattaggaataaaaatagcgattcga
cacggagattcaacggagaggcaaagaaaaaggatcttggaagatccacctgatttactt
ctaacaacacctgaaacattgctctatttactagtaaaccagaaaatgagagaattatta
ggaaatataagatggatcattatagatgaattacaagaaatgcttgatgagaaacggggt
tatgaattacttttagctattcaaagattaaagaggttaagtaagtatgagattcaactg
attggactttcagcaacaataggcgatattgaattagcgaagaggtttattggaaggaac
gtagaggtcgccgaatacaataccagaaaagatgtaaaaatagagttggtcataccaaca
gtttcaaaggatcttgctgagttatcatataagacaggcttacatccagatacgctggct
agaataagagaacttgaaaaattgataaaagagaataaaccagttcttgttttcactaac
gttagagagagtacagaatttctagcctccgaattgtcaaaattgtctcaactaaaagtg
agaacacatcatggctctctatcgagagaaataagattagaagctgaaaaagaatttaag
actggcaatcttgacgcattaatagccacttcaagcttagaacttggaatagatgtagga
acaattaatgcagtaattcaatatacctctccaaagcaagttataagacttgtacaaaga
attggaagaagtggacattcaataaataaagtttctagtggttttctattaccttctcat
gatatttttgacatattagaatgtaaaagtataattgacaatttaaaggaaggataccta
gaaaaaccaatagtagaacctaaaccttatgatgttatggcacacgaaattgcaggtcta
gtactagaaggcattacagataagaaagaaatctttaacttaatcaaatcatcatttcaa
tacaacgacttaacagaagaggaatttgaagaaacattaagtatacttgaatctgcaaga
ataattagaaagaataaagataagatatcaccggcaggaagattatggagatattattat
agtacgaatatgataccagactctataaaagattacatagtcatagaccatatttctaac
actaaaataggaacgttagactatgaattcgtggctacactggatgaaaataccgtattc
atactgggaggaaaaatttggagagtagtatcaatagaggaaaatcgtatttatgtcgaa
aacgcacaactgaaaagcggagtcttgccaagctggtttggtgagtcaattccagttgaa
agagaaatttccattaaggtgtatgattatattgaaagaatagaaagaggagatcaaata
gacctaccgaaagaaatacttgaaaagatctcttcgttactagaagaacaaaaaaggcga
ggataccctgttccaactaaaagtaaaatccttgtagaaataaataatgatctaatagtt
ttacatgcaggattaggaagtagaggtaataataccctaggtgcgttattatcactttta
ttaacccaagtaaaaggagtgagaactacgtataggtctgatccctatcatatagcaata
gcctccttagttccagtatcaaaggaggaatttacaaaggcaataaaaatactaaatagt
ctaagttctagtgaatttgaagaccttctgaagagggctataaaagaaagtccacagtat
aaatggaaactcttgattgaggcggaaagattcggtcttatagacaaacaaaaaaccgat
ataacattctcccagactctccttaaagcttatactgataccttagttggagaagaagca
gtgaaagaacttatgtataaaaactatgatgtaacacttagggaattcctaactcgactt
acttgggaatgtatagaagtaccaggcttctccccactagctaaagaattccttaacaaa
ctatttgttgcagcacattcagatgaaaaaggagtaatgatagagatatttagacgtaaa
ttgttaaataataaggttaaaataatttgtatggtgtgcgggtggaataatatatattat
gctgctgaggtaccggataggtgtaccaagtgtggctcaatattcttaaccgtaactgat
gaggatgataaagaaagtgtggaaattattaaaaaggtcattaaaggttcaaagatctcg
aagaacgaaaaaaagaaatttgaaatacttcagaatatttcatcaatgttttcaacttac
aaaaaatatgttgccataggattgagtgcaagaggagtaggaataaataacattgggaaa
gtccttaataagctcagcgatggagaggacaggttttttgagagtctacttgaggaggaa
agaaagtttttaagaacacgcaagtactggcagtaa

DBGET integrated database retrieval system