KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0911Help
Entry
Saci_0911         CDS       T00251                                 

Gene name
adh
Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K15020  
acryloyl-coenzyme A reductase [EC:1.3.1.84]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Hydroxypropionate-hydroxybutylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sai01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sai00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731144..732148
Genome map
AA seq 334 aa AA seqDB search
MKAIVVPAPKQNYSLQEVKDPKPNSDEVVIRVVRAGLCYRDLLQLQGYYPRMKYPVVLGH
EVVGEIEEVGDNVSGFKIGDRVISLLYAPDGSCEYCKVGEEAYCKRRLGYSEELDGFFAE
RAKVKVTSIVKVPQSVSDDAAVIVPCVTGMIYRGIRRAGGINKNEYALVTGASGGVGIHA
IQVAKALGARTIGVTTSEDKAKVIRKYADHVIVGSKFSDEARKIGDISLVIDTVGTPTIE
ESLRSLRMGGKLVQIGNVDPSQIYSLRLGYLILKDILLVGHASATKYDAEQTLKLTEGGN
ISAVVAGHVNLDNIDEGYRMIKDRNKIGKVLLKP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctatagtggttcctgctcccaaacaaaattactcattgcaagaggttaaagat
cctaaaccaaacagtgatgaagttgttataagagtagttagagctggattatgctacaga
gatctgttacaactccagggttactatcccagaatgaaatatccggtagttttaggacat
gaggttgtaggagaaatagaggaagtaggggataacgttagtggctttaagataggagat
cgagtgatttccctactttatgcaccagacggaagttgtgaatattgtaaagtaggcgag
gaggcttactgcaaaagaagactaggctattcagaggagctagatggcttttttgctgaa
agagctaaagttaaggttacaagtattgtgaaagttccacaatctgtgagtgatgatgca
gcggtgattgttccatgtgtcactggcatgatatataggggtataaggagagctggagga
atcaataagaatgaatacgctctagttacaggagcaagcggaggtgttggtattcacgca
atacaggtcgcaaaagcattaggggcaagaacaataggtgttaccacctctgaagataaa
gctaaagtaattagaaaatatgcagatcacgttatagtgggaagtaagttttcagatgag
gcaagaaagatcggagatataagtttagtaatagacactgttgggacgcctactattgag
gagagtcttagatcgctgagaatgggaggtaaacttgttcaaattggcaatgtagatcct
tctcagatatatagtttaaggttaggttatttgattttaaaggatattttattagtaggt
cacgcatcagctactaaatacgatgctgaacagacccttaaactcactgaaggaggaaac
ataagtgcagttgtagcaggtcatgtaaacttagacaatattgatgaaggctataggatg
attaaagatcgtaataagataggtaaagttctgctgaaaccataa

DBGET integrated database retrieval system