KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1079Help
Entry
Saci_1079         CDS       T00251                                 

Definition
glucose 1-dehydrogenase (EC:1.1.1.47)
Orthology
K18125  
aldose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.359]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Pentose phosphate pathway
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_1079
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Saci_1079
   00052 Galactose metabolism
    Saci_1079
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.359  aldose 1-dehydrogenase [NAD(P)+]
     Saci_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880693..881787
Genome map
AA seq 364 aa AA seqDB search
MRAIIIRPPNAGAEIKEIKDAQNYGKVKIKSLYSGVCGTDRELVNGKLSLGKAHKDRDYL
VLGHEAIGVVEESVGEFSKGDLVMPVNRRGCGKCLNCLLGRPDFCETGGFVEAGIYGMDG
FMREEWYDDPKYLVKIPKALEDIGILAQPLADIEKSLQEIDDIQKRLPAWTCEDGTINCR
KMLVIGTGPIGLLFILLARTLGYEVWASNRRDPNETESVIIEEGKINYYNSSAGFEKLKD
SVGGFDVIVDATGANAQLLDKVIPLLNRNGILGIFGFPSDGIFSISYKDLQTLVHGNKLI
LGLVNGQKPHFQQAIVHLASWKTMYPKTSKLLVTRTISINDENEVMKALKEKQAEEIKVR
IIWD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagagctataataataagacctcctaatgccggagcagaaattaaggagataaaggac
gcacagaattatgggaaagtaaagataaagagcctctattcaggagtatgtggtacagac
agggagcttgtaaatggtaaactatctttaggcaaagcacataaggacagagattacctg
gtattaggtcatgaagcgattggagtggttgaggagtcagtgggtgagttctccaaggga
gaccttgtcatgccggtaaacaggagaggatgtgggaaatgtcttaattgtttattagga
agaccagatttctgtgagaccggaggattcgttgaggcaggcatatacggtatggacggt
tttatgagagaggagtggtatgatgatcctaaatatttagttaaaatacccaaagctcta
gaggacataggtatattagcacagcctctagcggatattgaaaaatctttacaggaaata
gatgatatccaaaaaaggctccctgcatggacatgtgaggacgggacaataaattgtaga
aaaatgttagttataggtacaggacccattgggctacttttcattttacttgcaagaact
ttaggttatgaggtatgggcaagcaatagaagggatcctaatgaaactgagagtgttata
atagaagagggaaagatcaactactataactcgtcagcagggttcgaaaagctgaaagac
tctgttggaggatttgatgtaatagttgacgcaacaggtgctaacgctcaattgctcgat
aaggtaattcctctattaaacaggaatggtatactagggatattcggttttcccagtgac
ggtatattttcaataagttataaggatcttcaaacgctagttcatggtaataaattaatc
ttaggtttagttaacgggcaaaaacctcattttcaacaggcaattgtgcacttagcatct
tggaagaccatgtatcctaaaacctcgaaacttctagtgactagaacaattagtataaat
gacgaaaatgaggtaatgaaagccttaaaggagaaacaagcagaggaaataaaagttaga
ataatttgggactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system