KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1115Help
Entry
Saci_1115         CDS       T00251                                 

Gene name
adh
Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Saci_1115 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_1115 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Saci_1115 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Saci_1115 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saci_1115 (adh)
   00626 Naphthalene degradation
    Saci_1115 (adh)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Saci_1115 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(918125..919132)
Genome map
AA seq 335 aa AA seqDB search
MKAVILPGFKQGYKIDKNVQEPKAGKSEVVVKLRKAALCYRDLLQIQGFYPRSKYPLILG
HEMVGEIEEVGEGVEGFKKGDIVTSLLYVPDWTCDNCKMGEEIYCNNRQLYAQELDGFFA
ERILVKANSLVKVPPGVSDEGAVVVPCVAAMIYRGLKRANVKQGDIVLVTGAGGGVGIHA
LQVAKALGAKVVGVTSEESKAKIVGKFSDYVVVGNKFAEEVRKGFGEPSIVVDNVGGPTL
DESMRSLKIGGKIVQVGNIDPSVNFSLRLGYLVLKNVELIGHAGATKKDIVDTLEMVRQN
KITPVIGGEVSIEDFDKALDMLKDRKRHGKILIKP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtaattcttccaggttttaaacaaggttataaaatagataaaaacgtgcaa
gagccaaaggcaggtaaatcagaagttgtggtaaagttaaggaaagcagcactatgttat
agagaccttcttcagatccaaggattttatccccgctcaaaataccctcttatattgggg
catgagatggtaggagaaattgaggaagttggagaaggtgttgagggattcaaaaagggt
gatattgtgacctcactactttacgttccagattggacttgtgacaactgtaagatggga
gaagagatatattgtaacaacagacaactctatgcacaggagcttgacggatttttcgca
gagagaatacttgtgaaagcaaactctcttgttaaagtccctcctggagtttcagatgaa
ggggctgtagtagttccctgtgttgctgcaatgatttacagagggcttaagagagctaat
gtaaagcagggggatatagttttagtgactggtgcaggaggtggtgttggtattcatgcc
cttcaggttgctaaagctttaggagcaaaagtagtaggagtaacaagtgaagagagtaag
gctaagatcgttggaaaattttcagattacgtggtagttgggaacaagtttgctgaagag
gttagaaagggatttggagaaccttcaatagtagtggacaatgtaggaggtcctactctt
gatgagagtatgaggtcactgaaaataggtggtaagatagtacaagtagggaatattgat
ccctctgtcaatttcagtctaaggctaggttacttagtcctaaagaatgttgagttaatt
ggacatgccggggctacaaagaaggacatagtggacacattggagatggttaggcaaaat
aagattacgccagttataggtggtgaggtatcaatagaggattttgataaggctttagat
atgttgaaggacagaaaaagacatggtaaaattcttataaagccataa

DBGET integrated database retrieval system