KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1393Help
Entry
Saci_1393         CDS       T00251                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188647..1189630
Genome map
AA seq 327 aa AA seqDB search
MKALFFEKSGLNNLKFGDIKEPEIGAHDVLIRVKMAGVNPIDYFVVEGIPVKPLPHIPGA
EIYGEIVKVGEHVKSVKPGDKVVVYNRVFDGECDFCLAGMEMLCRNGGIISVITNGGFSE
YFAVPEKNVFKVNLPDEVAASLPVAALTSYHALKEANVKPTDVVVVFGASGNTGQFALQL
ARKMGATTIAVSRKQWVKDFADYVVDYENAENKIKDLTGGKLADVVINSVGTSIWDLSLK
VLGVNGRLVFFGGLTGSDGKINISALYGKHQKLIGTTGGSRKEMVELISLCKDCKVKVSK
VYNLEDGKEALASIMKDRDGRPMIKIS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttattcttcgaaaagagtggtttaaacaacctaaaatttggagatataaaa
gaacctgagataggtgcacatgatgtattaataagagttaaaatggcaggagtaaaccct
atagattactttgtcgtggagggaataccggtaaagccactaccacatattccaggagca
gaaatttacggagaaattgtaaaagtaggagaacatgttaaatcagtaaagccaggagac
aaagtagtagtgtataatagagtatttgatggagagtgtgacttctgccttgccgggatg
gaaatgttatgcagaaatggtggaataattagtgttataacaaatggtggattctcagag
tattttgctgtaccagaaaagaacgtatttaaggttaacttacctgatgaagtagctgca
agtttaccagttgcagctttgacctcttatcatgcgttaaaggaagcaaacgttaaacca
acagatgttgtagtagtatttggagcctcaggtaatacaggacaatttgcactacaatta
gctagaaagatgggtgccacaacaatagctgtaagtagaaaacagtgggttaaggatttt
gctgattatgttgttgactatgaaaacgctgaaaataagattaaagatctaacaggtggg
aaattagctgatgtagtaattaattctgttggaacttcaatatgggacttaagcctaaaa
gtgctaggagtgaatggtagactagtgttcttcggtggacttacgggatctgatggaaaa
ataaatatctcagcattatacggaaagcaccaaaagctaattggaactactggaggaagt
agaaaagaaatggtagaacttatctcgttatgcaaagactgcaaagtcaaggtatctaag
gtatataatcttgaagacggtaaagaagcccttgcaagtattatgaaagatagggacgga
agaccaatgattaaaatctcttga

DBGET integrated database retrieval system